Report for Sequence Feature Glyma08g41710
Feature Type: gene_model
Chromosome: Gm08
Start: 41647511
stop: 41651207
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g41710
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G36900 AT
Annotation by Michelle Graham. TAIR10: membrin 11 | chr2:15491615-15492587 REVERSE LENGTH=225
SoyBase E_val: 8.00E-92 ISS
GO:0016192 GO-bp
Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport
SoyBase N/A ISS
GO:0000139 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi membrane
SoyBase N/A ISS
GO:0005789 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0005484 GO-mf
Annotation by Michelle Graham. GO Molecular Function: SNAP receptor activity
SoyBase N/A ISS
KOG3251
KOG
Golgi SNAP receptor complex member
JGI ISS
PTHR21230 Panther
VESICLE TRANSPORT V-SNARE PROTEIN VTI1-RELATED
JGI ISS
PTHR21230:SF1 Panther
MEMBRIN
JGI ISS
PF12352 PFAM
Snare region anchored in the vesicle membrane C-terminus
JGI ISS
UniRef100_G7K371 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Golgi SNAP receptor complex member n=1 Tax=Medicago truncatula RepID=G7K371_MEDTR
SoyBase E_val: 7.00E-119 ISS
UniRef100_I1KXX2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KXX2_SOYBN
SoyBase E_val: 1.00E-161 ISS
Expression Patterns of Glyma08g41710
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma08g41710
Paralog Evidence Comments
Glyma18g14390 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g41710 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g304700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g41710
Coding sequences of Glyma08g41710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g41710.1 sequence type=CDS gene model=Glyma08g41710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAAGGAGGTGGAGGAACGCTCTCGGAGATTCACCAATCCGCGAAGAAGCTCCTGCTGAGGTCTCGCGACGGCCTCGAACGTCTCGAACGCCTCGAGTACTCTGCCGCCGCCGGTGCCGCCTTCTCGGGCGCCGACTCCGAGCTGTCTTTCGCCGTGAAGAAGGATATCACACAGATCCAAACCCTCTGCGTCGAGATGGACCGACTCTGGCGATCCATCGCCGCAAAACCTCAGCGCGATCTCTGGAAAAGAAAAGTGGAACAAATAGCTGAAGAGGCTGAATCACTGAGAGCAAGTTTGGATAAATATAACTTACGGAATCAGAAACGAATGAGAGAAGCTAATGAGAGAACAGAACTCTTGGGACGAGCTAATGGGGATTCTGCTCATGTTTTGAGAATTTATGATGAGGAGGCACAAGCATTACAGTCAGTTCGCTCTTCTTCCCGGGAACTGGAAAATGCAAATGCTCTTGGGGAGGCCATCCTTTCTTCAATACATGGCCAAAGAGAACGCTTGAAGAGTGCACATCGAAAAGCATTGGACATCCTCAATACAGTGGGAATATCAAACTCTGTTTTGAGGCTAATTGAGAGACGAAACCGAGTCGACCAGTGGATCAAATATGCAGGAATGCTATTGACTGTCGTTTTCCTGTTCGCGTTTATTATGTGGAGACATTGA
Predicted protein sequences of Glyma08g41710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g41710.1 sequence type=predicted peptide gene model=Glyma08g41710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEGGGGTLSEIHQSAKKLLLRSRDGLERLERLEYSAAAGAAFSGADSELSFAVKKDITQIQTLCVEMDRLWRSIAAKPQRDLWKRKVEQIAEEAESLRASLDKYNLRNQKRMREANERTELLGRANGDSAHVLRIYDEEAQALQSVRSSSRELENANALGEAILSSIHGQRERLKSAHRKALDILNTVGISNSVLRLIERRNRVDQWIKYAGMLLTVVFLFAFIMWRH*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
