Report for Sequence Feature Glyma08g41416
Feature Type: gene_model
Chromosome: Gm08
Start: 41395695
stop: 41398980
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g41416
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G07910 AT
Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Reactive oxygen species modulator 1 (InterPro:IPR018450); Has 192 Blast hits to 192 proteins in 80 species: Archae - 0; Bacteria - 0; Metazoa - 139; Fungi - 6; Plants - 39; Viruses - 0; Other Eukaryotes - 8 (source: NCBI BLink). | chr3:2523367-2524048 REVERSE LENGTH=74
SoyBase E_val: 3.00E-26 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG4096
KOG
Uncharacterized conserved protein
JGI ISS
PF10247 PFAM
Reactive mitochondrial oxygen species modulator 1
JGI ISS
UniRef100_Q9SFC3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: AT3g07910/F17A17_25 n=1 Tax=Arabidopsis thaliana RepID=Q9SFC3_ARATH
SoyBase E_val: 2.00E-23 ISS
UniRef100_UPI00023389C8 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI00023389C8 related cluster n=1 Tax=unknown RepID=UPI00023389C8
SoyBase E_val: 1.00E-43 ISS
Expression Patterns of Glyma08g41416
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g41416
Paralog Evidence Comments
Glyma18g14801 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g41416 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g302200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g41416
Coding sequences of Glyma08g41416
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g41416.1 sequence type=CDS gene model=Glyma08g41416 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAAGGGATAGCTGCCTCACTCGTGTCACCGCCGGCGCCGCTATGGGCGGCGCTGTCGGCGGCGCCGTCGGTGCTGTGTATGGAACATATGAAGCTATTAGGTACAAGGTGCCTGGACTATTGAAAATTAGGCATATTGGACAAACTACACTTGGAAGTGCTGCTATTTTTGGTCTTTTCTTGGGTGCTGGAAGCTTGATACATTGTGGGAAATCATACTGA
Predicted protein sequences of Glyma08g41416
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g41416.1 sequence type=predicted peptide gene model=Glyma08g41416 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MARDSCLTRVTAGAAMGGAVGGAVGAVYGTYEAIRYKVPGLLKIRHIGQTTLGSAAIFGLFLGAGSLIHCGKSY*