SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g41416

Feature Type:gene_model
Chromosome:Gm08
Start:41395695
stop:41398980
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g41416
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07910AT Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Reactive oxygen species modulator 1 (InterPro:IPR018450); Has 192 Blast hits to 192 proteins in 80 species: Archae - 0; Bacteria - 0; Metazoa - 139; Fungi - 6; Plants - 39; Viruses - 0; Other Eukaryotes - 8 (source: NCBI BLink). | chr3:2523367-2524048 REVERSE LENGTH=74 SoyBaseE_val: 3.00E-26ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4096 KOG Uncharacterized conserved protein JGI ISS
PF10247PFAM Reactive mitochondrial oxygen species modulator 1 JGI ISS
UniRef100_Q9SFC3UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3g07910/F17A17_25 n=1 Tax=Arabidopsis thaliana RepID=Q9SFC3_ARATH SoyBaseE_val: 2.00E-23ISS
UniRef100_UPI00023389C8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023389C8 related cluster n=1 Tax=unknown RepID=UPI00023389C8 SoyBaseE_val: 1.00E-43ISS

Expression Patterns of Glyma08g41416
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g41416 not represented in the dataset
Glyma08g41416 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g41416
ParalogEvidenceComments
Glyma18g14801 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g41416 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g302200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g41416
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g41416
>Glyma08g41416.1   sequence type=CDS   gene model=Glyma08g41416   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAGGGATAGCTGCCTCACTCGTGTCACCGCCGGCGCCGCTATGGGCGGCGCTGTCGGCGGCGCCGTCGGTGCTGTGTATGGAACATATGAAGCTATTAGGTACAAGGTGCCTGGACTATTGAAAATTAGGCATATTGGACAAACTACACTTGGAAGTGCTGCTATTTTTGGTCTTTTCTTGGGTGCTGGAAGCTTGATACATTGTGGGAAATCATACTGA
Predicted protein sequences of Glyma08g41416
>Glyma08g41416.1   sequence type=predicted peptide   gene model=Glyma08g41416   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARDSCLTRVTAGAAMGGAVGGAVGAVYGTYEAIRYKVPGLLKIRHIGQTTLGSAAIFGLFLGAGSLIHCGKSY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo