SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g41365): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g41365): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g41365

Feature Type:gene_model
Chromosome:Gm08
Start:41363096
stop:41366053
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G25940AT Annotation by Michelle Graham. TAIR10: TFIIB zinc-binding protein | chr3:9495104-9495942 FORWARD LENGTH=119 SoyBaseE_val: 4.00E-14ISS
GO:0006351GO-bp Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR11851Panther METALLOPROTEASE JGI ISS
PTHR11851:SF69Panther SUBFAMILY NOT NAMED JGI ISS
PF01096PFAM Transcription factor S-II (TFIIS) JGI ISS
UniRef100_C6T4H3UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA-directed RNA polymerase subunit n=1 Tax=Glycine max RepID=C6T4H3_SOYBN SoyBaseE_val: 2.00E-34ISS
UniRef100_UPI000233D717UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D717 related cluster n=1 Tax=unknown RepID=UPI000233D717 SoyBaseE_val: 9.00E-65ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g41365 not represented in the dataset

Glyma08g41365 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g41365.1   sequence type=CDS   gene model=Glyma08g41365   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGGCTGAGGTTGTCAAGAATTCTTGGAAAAAAAGAGCAAAGGAATCAGTCGTGATTAGTAAAGGGGAGGGCTCTGATTTTGTGGCAAAAGCTGTGGATTTAGCAGCCAGAGAATTAATAACAAGTGCATCACTAGGACAAGTTACACAGGTACAGCTTGACCGTGCCAAGGTATCCACGAAGTCTGCAGTTCTAATGAATTTAGAGTCCAGAGATATCAGAAGAGAGCTTGGAATGGAAATAATTGAGGAACATATGGTGATGGAATATTCTAAGGTCAACAAGAAATGTGAAAAATGTGGCCATGGGGAAGCTACCTATTATACTAGACTGATGAGATCAGCAGACAAAGGGCAAACTACTTTCTACACATGTATCGGCTATGGTCATCCGTCTCAGGAGAATTAG

>Glyma08g41365.1   sequence type=predicted peptide   gene model=Glyma08g41365   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLAEVVKNSWKKRAKESVVISKGEGSDFVAKAVDLAARELITSASLGQVTQVQLDRAKVSTKSAVLMNLESRDIRRELGMEIIEEHMVMEYSKVNKKCEKCGHGEATYYTRLMRSADKGQTTFYTCIGYGHPSQEN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo