SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g41305): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g41305): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g41305

Feature Type:gene_model
Chromosome:Gm08
Start:41296920
stop:41297866
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
UniRef100_UPI000233A4F2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A4F2 related cluster n=1 Tax=unknown RepID=UPI000233A4F2 SoyBaseE_val: 1.00E-07ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g41305 not represented in the dataset

Glyma08g41305 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g301400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g41305.1   sequence type=CDS   gene model=Glyma08g41305   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAACAGGTACTACTTTGTCGATGGACTCAAGGACTTCAGAAGAAGCCTCGACCATGAAGGTGTTATGGTCAGTTTTGTTGCACCTGAGTTTTGATATCCATTTCATGCCACCATTGCATATACAAACATGTGCAAGACCTCCCACAACCAGTATAACTTATGTCTTTATTGTTGATGTTACCCACCTTTTGATCTCACGTCCTTCACCCTTGTTCCTGCCACCCGATGCAAGCGATTTGGTTGATGCATTAACACAATATATGACTGTCCAACGTAGTAGTGGTCGTCGTCACATATGGAGGATCTCCATGCATAATGGGCTATGA

>Glyma08g41305.1   sequence type=predicted peptide   gene model=Glyma08g41305   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVTGTTLSMDSRTSEEASTMKVLWSVLLHLSFDIHFMPPLHIQTCARPPTTSITYVFIVDVTHLLISRPSPLFLPPDASDLVDALTQYMTVQRSSGRRHIWRISMHNGL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo