Glyma08g41251 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g41251): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g41251): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g41251

Feature Type:	gene_model
Chromosome:	Gm08
Start:	41261905
stop:	41262564
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g41251

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATMG00270	AT	Annotation by Michelle Graham. TAIR10: NADH dehydrogenase 6 \| chrM:76642-77259 REVERSE LENGTH=205	SoyBase	E_val: 1.00E-130	ISS
GO:0045333	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular respiration	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005747	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I	SoyBase	N/A	ISS
GO:0003954	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase activity	SoyBase	N/A	ISS
GO:0008137	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity	SoyBase	N/A	ISS
PF00499	PFAM	NADH-ubiquinone/plastoquinone oxidoreductase chain 6	JGI		ISS
UniRef100_Q7ILE5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NADH-ubiquinone oxidoreductase chain 6 n=2 Tax=Lupinus RepID=Q7ILE5_LUPLU	SoyBase	E_val: 1.00E-136	ISS
UniRef100_UPI0002338833	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002338833 related cluster n=1 Tax=unknown RepID=UPI0002338833	SoyBase	E_val: 1.00E-155	ISS

Expression Patterns of Glyma08g41251

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g41251 not represented in the dataset	Glyma08g41251 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g41251 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g301000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g41251

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g41251

Limit To All Plant Sequences

>Glyma08g41251.1   sequence type=CDS   gene model=Glyma08g41251   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATACTTTCTGTTTTGTCGAGCCCTGCTTTGGTCTCTGGTTTGATGGTTGCACGTGCTAAAAATCCGGTACATTCTGTTTTGTTTCCCATCCCAGTCTTTCGCGACACTTCAGGTTTACTTCTTTTGTTAGGTCTCGACTTCTCCGCTATGATCTTCCCAGTAGTTCATATAGGAGCTATAGCCGTATCATTCCTATTCGTTGTTATGATGTTCCATATTCAAATAGCGGAGATTCACGAAGAAGTATTGCGCTATTTACCAGTGAGTGGTATTATTGGACTGATCCTTTGGTGGGAAATGTTCTTCATTTTAGATAATGAAACCATTCCATTACTACCAACCCAAAGAAATACTACCTCTCTTAGATATACGGTTTATGCCGGAAAGGTACGAAGTTGGACTAATTTGGAAACATTGGGCAATTTACTTTATACCTACTATTTCGTCTGGTTTTTGGTTCCTAGTCTAATTTTATTAGTTGCCATGATTGGGGCTATAGTACTTACTATGCATAGGACTACTGAGGTAAAAAGACAGGATGTTTTCCGACTAAATGCTATTGATTTTAGGAGGACTATAATGAGGAGGACGACAGACCACTCACGATCGACTAAAAGGAAAGTCGCCCGGAGATATTGGTTCAAATCCAATTCGTGA

Predicted protein sequences of Glyma08g41251

Limit To All Plant Sequences

>Glyma08g41251.1   sequence type=predicted peptide   gene model=Glyma08g41251   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MILSVLSSPALVSGLMVARAKNPVHSVLFPIPVFRDTSGLLLLLGLDFSAMIFPVVHIGAIAVSFLFVVMMFHIQIAEIHEEVLRYLPVSGIIGLILWWEMFFILDNETIPLLPTQRNTTSLRYTVYAGKVRSWTNLETLGNLLYTYYFVWFLVPSLILLVAMIGAIVLTMHRTTEVKRQDVFRLNAIDFRRTIMRRTTDHSRSTKRKVARRYWFKSNS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain