SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g41081): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g41081): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g41081

Feature Type:gene_model
Chromosome:Gm08
Start:41124556
stop:41126772
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G05290AT Annotation by Michelle Graham. TAIR10: peroxisomal adenine nucleotide carrier 1 | chr3:1506129-1507614 REVERSE LENGTH=322 SoyBaseE_val: 3.00E-50ISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006839GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrial transport SoyBaseN/AISS
GO:0007031GO-bp Annotation by Michelle Graham. GO Biological Process: peroxisome organization SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0015866GO-bp Annotation by Michelle Graham. GO Biological Process: ADP transport SoyBaseN/AISS
GO:0015867GO-bp Annotation by Michelle Graham. GO Biological Process: ATP transport SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080024GO-bp Annotation by Michelle Graham. GO Biological Process: indolebutyric acid metabolic process SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0090351GO-bp Annotation by Michelle Graham. GO Biological Process: seedling development SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005743GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0005347GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP transmembrane transporter activity SoyBaseN/AISS
GO:0015217GO-mf Annotation by Michelle Graham. GO Molecular Function: ADP transmembrane transporter activity SoyBaseN/AISS
PTHR24089Panther FAMILY NOT NAMED JGI ISS
PTHR24089:SF36Panther SUBFAMILY NOT NAMED JGI ISS
PF00153PFAM Mitochondrial carrier protein JGI ISS
UniRef100_D7L3S5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial substrate carrier family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7L3S5_ARALL SoyBaseE_val: 1.00E-48ISS
UniRef100_UPI000233882EUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233882E related cluster n=1 Tax=unknown RepID=UPI000233882E SoyBaseE_val: 2.00E-77ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g41081 not represented in the dataset

Glyma08g41081 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g299500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g41081.1   sequence type=CDS   gene model=Glyma08g41081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATCCTTAGCTGAAGCAACCTCGGGAGTCATAGGATCACTTTTGAGCACCACTATGTTGTGCCCTCTTGACACTTGCACGACCAAGTTCCAAAGTACAGTGTTAATAGAAGCAGTATCTAGTGGTCAGGTGCTTTCGCTATACCAGGGCATTGGAACCAAGAATCTTCACTCTTTTTTTGCAAAGTTTGTCTACTTCTATGGCTACAGCTATTTTAAAAAACTCTATTTGGATAGAAGTGGTTCTAAATCCATTGGAGCCAAAGCAAACTTGGCAATTGCTGCTGTTGCTGGGGCCTGCACAGCCATTGTGACTCAGAAGACCACATGGAATGATGCATTTGGTGGCCTCAGCATTTCCCTGATGCTGACACCAAACCCTGCAATTTAG

>Glyma08g41081.1   sequence type=predicted peptide   gene model=Glyma08g41081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESLAEATSGVIGSLLSTTMLCPLDTCTTKFQSTVLIEAVSSGQVLSLYQGIGTKNLHSFFAKFVYFYGYSYFKKLYLDRSGSKSIGAKANLAIAAVAGACTAIVTQKTTWNDAFGGLSISLMLTPNPAI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo