SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g41040

Feature Type:gene_model
Chromosome:Gm08
Start:41070753
stop:41071864
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g41040
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G26920AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G69760.1); Has 47 Blast hits to 47 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 7; Plants - 34; Viruses - 0; Other Eukaryotes - 6 (source: NCBI BLink). | chr1:9329584-9330105 FORWARD LENGTH=173 SoyBaseE_val: 4.00E-27ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1KXS2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KXS2_SOYBN SoyBaseE_val: 2.00E-126ISS
UniRef100_Q3LVG1UniRef Annotation by Michelle Graham. Most informative UniRef hit: TO109-12 (Fragment) n=1 Tax=Taraxacum officinale RepID=Q3LVG1_TAROF SoyBaseE_val: 2.00E-13ISS

Expression Patterns of Glyma08g41040
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g41040
ParalogEvidenceComments
Glyma18g15552 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g41040 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g299000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g41040
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g41040
>Glyma08g41040.1   sequence type=CDS   gene model=Glyma08g41040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAAAGTGTGCTAACAAAGAGGCCAAGAGAAGAAGAACCCCTAGAGAACAAAGATAGTACTTATGAATTACTAGAGTCCTTATCAAAGAGGCACAGGTCATACAACCACATACTCTCCCTCCTTGAATCAGAGGAAGATGACTCCACACAAGACCTATCTTCTCTCATCACTTCCCTCCAACAAGAAATCACCAATTGTGCCTCTGATTCGGACACCCTTTTGAACCAACACAGCCTCACCAACACCACCACCACCACCACAACAAATAGTAATTTAGAGGATTGTTCATCCTCAACAACTAAATATTCTAGTGACATGATGGAGGAACATGATGACAAAGAAGGGGTCATGAGACACCTTCTTGAAGCTTCTGATGATGAACTTGGGATTCCAAATAAAGAGGATGAATCACTCGATCTTGGTGAAGATGGGTTCAAGTTCAACGGTGGAGACATGTTTTCTTCAATTTGTGATGGGTTGTTGTGGGAGCTTGAAGATGAAGCTGCTAACTACTATGATCTTTTGCAGTCTCAACTCTTTCTCTAG
Predicted protein sequences of Glyma08g41040
>Glyma08g41040.1   sequence type=predicted peptide   gene model=Glyma08g41040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEESVLTKRPREEEPLENKDSTYELLESLSKRHRSYNHILSLLESEEDDSTQDLSSLITSLQQEITNCASDSDTLLNQHSLTNTTTTTTTNSNLEDCSSSTTKYSSDMMEEHDDKEGVMRHLLEASDDELGIPNKEDESLDLGEDGFKFNGGDMFSSICDGLLWELEDEAANYYDLLQSQLFL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo