SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g40541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g40541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g40541

Feature Type:gene_model
Chromosome:Gm08
Start:40281416
stop:40284302
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G59640AT Annotation by Michelle Graham. TAIR10: BIG PETAL P | chr1:21909464-21911030 REVERSE LENGTH=264 SoyBaseE_val: 3.00E-94ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009062GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process SoyBaseN/AISS
GO:0009694GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid metabolic process SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0048441GO-bp Annotation by Michelle Graham. GO Biological Process: petal development SoyBaseN/AISS
GO:0048443GO-bp Annotation by Michelle Graham. GO Biological Process: stamen development SoyBaseN/AISS
GO:0048446GO-bp Annotation by Michelle Graham. GO Biological Process: petal morphogenesis SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PTHR12565Panther STEROL REGULATORY ELEMENT-BINDING PROTEIN JGI ISS
PTHR12565:SF7Panther CENTROMERE-BINDING PROTEIN 1, CBP-1 JGI ISS
PF00010PFAM Helix-loop-helix DNA-binding domain JGI ISS
UniRef100_G7LEL6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bHLH79 n=1 Tax=Medicago truncatula RepID=G7LEL6_MEDTR SoyBaseE_val: 1.00E-117ISS
UniRef100_UPI000233886FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233886F related cluster n=1 Tax=unknown RepID=UPI000233886F SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g40541 not represented in the dataset

Glyma08g40541 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g294000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g40541.1   sequence type=CDS   gene model=Glyma08g40541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCCGGGCGCGATGATGAACGAGGGTTCCTTCGCGAACAATGCGAGCGGTAATACGGCGCCGTTTAGCTTGGCGGAGATCTGGCAGCAGTTCCCGCCGGCGATTAGTGGCGGCGGTGGATTGGGGCTCAGAAGCCCGCAGTTCGGTCACGGGCCAGGAGGGCAGTTTGGGGATTTCACCACCGGGCCGAGCCACGGACTCGGACCCAGTAACAGCAGAAAGCGGCGCGACTCCGAGGAGGACGATTCCGCTAAGGGCGTGTCCACCAGCAATGCCGTGAATGAGGGTGATGGAAAACGTGTTAAAGGGAATAGGAACGAGGGTGGTGGTGATGGTGGTAATAATAAAGGTGAAGGTGAAGTCAGTTCAGGAAAGCCTGCGGAGCAAAGCGCTAAGCCAGCTTCGGAGCCTCCGAAGCAAGACTACATTCACGTTCGAGCCAGAAGGGGTCAAGCCACTGATAGTCACAGTCTTGCAGAACGAGCTCGAAGGGAAAAGATTAGTGAAAGGATGAAAATTCTTCAGGATTTGGTCCCTGGTTGTAATAAGGTTATTGGGAAAGCATTGGTCCTTGATGAGATAATTAATTATATTCAATCTCTTCAGCGCCAAGTTGAGTTTTTGTCAATGAAGCTTGAAGCAGTGAATTCAAGACTTAACTCTGGTATTGAAGCGTTTCCTCCTAAAGATTTTGGTCAGCAAGCATTTGATCCTGCTGGCATACCATTCGGTTCGCAAGCTCCAAGAGAGTATAGCAGAGGTTCTTCACCAGACTGGTTACATATGCAGATAGGAGGTAGTTTTGAAAGAACAACGTAG

>Glyma08g40541.1   sequence type=predicted peptide   gene model=Glyma08g40541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPGAMMNEGSFANNASGNTAPFSLAEIWQQFPPAISGGGGLGLRSPQFGHGPGGQFGDFTTGPSHGLGPSNSRKRRDSEEDDSAKGVSTSNAVNEGDGKRVKGNRNEGGGDGGNNKGEGEVSSGKPAEQSAKPASEPPKQDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQRQVEFLSMKLEAVNSRLNSGIEAFPPKDFGQQAFDPAGIPFGSQAPREYSRGSSPDWLHMQIGGSFERTT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo