Glyma08g40490 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g40490): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g40490): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g40490

Feature Type:	gene_model
Chromosome:	Gm08
Start:	40219820
stop:	40225540
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g40490

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G10430	AT	Annotation by Michelle Graham. TAIR10: protein phosphatase 2A-2 \| chr1:3428705-3430437 REVERSE LENGTH=306	SoyBase	E_val: 0	ISS
GO:0006470	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein dephosphorylation	SoyBase	N/A	ISS
GO:0006499	GO-bp	Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation	SoyBase	N/A	ISS
GO:0009903	GO-bp	Annotation by Michelle Graham. GO Biological Process: chloroplast avoidance movement	SoyBase	N/A	ISS
GO:0034613	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular protein localization	SoyBase	N/A	ISS
GO:0005623	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004722	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine phosphatase activity	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
KOG0371	KOG	Serine/threonine protein phosphatase 2A, catalytic subunit	JGI		ISS
PTHR11668	Panther	SERINE/THREONINE PROTEIN PHOSPHATASE	JGI		ISS
PTHR11668:SF21	Panther	CALCINEURIN 1A	JGI		ISS
PF00149	PFAM	Calcineurin-like phosphoesterase	JGI		ISS
UniRef100_I1KXM8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine-protein phosphatase n=1 Tax=Glycine max RepID=I1KXM8_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_I1KXM8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Serine/threonine-protein phosphatase n=1 Tax=Glycine max RepID=I1KXM8_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma08g40490

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g40490 not represented in the dataset	Glyma08g40490 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g40490 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g293400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g40490

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g40490

Limit To All Plant Sequences

>Glyma08g40490.1   sequence type=CDS   gene model=Glyma08g40490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGTCTCACGCGGATCTGGAACGACAGATCGAGCAGCTGATGGAGTGCAAGCCTCTGTCGGAGTCGGAGGTGAAGGCGCTGTGTGATCAAGCGAGGGCGATTCTCGTGGAGGAATGGAACGTGCAACCGGTGAAGTGCCCCGTCACCGTCTGCGGCGATATTCACGGCCAGTTTTACGATCTCATCGAGCTGTTTCGGATTGGAGGGAACGCACCCGATACCAATTATCTCTTCATGGGTGATTATGTAGATCGTGGATACTATTCAGTGGAGACTGTTACACTTTTGGTGGCTTTGAAAGTCCGTTACAGAGATAGAATCACAATTCTCAGGGGAAATCATGAAAGTCGTCAAATTACTCAAGTGTATGGCTTCTATGATGAATGCTTGAGAAAATATGGAAATGCCAATGTCTGGAAATACTTTACAGACTTGTTTGATTATTTACCTCTGACTGCCCTCATTGAGAGTCAGATTTTCTGCTTGCATGGAGGTCTCTCACCTTCTTTGGATACACTGGATAACATCAGAGCATTGGATCGTATACAAGAGGTTCCACATGAAGGACCAATGTGTGATCTCTTGTGGTCTGACCCTGATGATCGCTGTGGATGGGGAATATCTCCACGTGGTGCAGGATACACATTTGGACAGGATATAGCTGCTCAGTTTAATCATACCAATGGTCTCTCCCTGATATCGAGAGCTCATCAGCTTGTTATGGAAGGATTCAATTGGTGCCAGGACAAAAATGTGGTGACTGTATTTAGTGCACCAAATTACTGTTACCGATGTGGGAATATGGCTGCTATACTAGAAATAGGAGAGAATATGGATCAGAATTTCCTTCAGTTTGATCCAGCGCCCAGGCAAATTGAGCCTGACACCACACGCAAGACTCCAGATTATTTTTTATAA

Predicted protein sequences of Glyma08g40490

Limit To All Plant Sequences

>Glyma08g40490.1   sequence type=predicted peptide   gene model=Glyma08g40490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPSHADLERQIEQLMECKPLSESEVKALCDQARAILVEEWNVQPVKCPVTVCGDIHGQFYDLIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAAQFNHTNGLSLISRAHQLVMEGFNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMDQNFLQFDPAPRQIEPDTTRKTPDYFL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain