SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g40480

Feature Type:gene_model
Chromosome:Gm08
Start:40214285
stop:40215645
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03610AT Annotation by Michelle Graham. TAIR10: GDSL-like Lipase/Acylhydrolase superfamily protein | chr5:915650-918326 FORWARD LENGTH=359 SoyBaseE_val: 5.00E-13ISS
GO:0006629GO-bp Annotation by Michelle Graham. GO Biological Process: lipid metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0016788GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds SoyBaseN/AISS
UniRef100_G7I351UniRef Annotation by Michelle Graham. Most informative UniRef hit: GDSL esterase/lipase n=1 Tax=Medicago truncatula RepID=G7I351_MEDTR SoyBaseE_val: 2.00E-24ISS
UniRef100_I1KXM7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KXM7_SOYBN SoyBaseE_val: 4.00E-131ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g40480.1   sequence type=CDS   gene model=Glyma08g40480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTACCAACCTCATATTTGAAAATTAAATCCCCCACACCTTATATATTTAGAAATTCCTCGGAACTACAATATGGTATGAACTTTGCTCACGGAGGGACTGGTATTTTCAACACTTTGGTTGATGGACCAAACATGACTTCTATACTAAAGCTGACCTTGAAAGCTCAAGTTGCTCTAGTGAATGCTGCGGGTAATGACTATGCTACATTTCTACTACGAAAACTTGGGAGCATACAAATTGATCAATACGACGATGATTATCCAAAATTATTTTTAAACTTGTTTTATCGACGATGGTTTTCACCAAAATTGTCATCGTATCAAATACGGTTTTGGTACAACCCTGGTTGTCCGAGCATCATTAAAATTTTTATTTATAGTAGTTTTTTTTTTTCCTTTTGTACAATGACGGCAATGAGGATTGAAGCTAGATATCCTCATGCATCTATCAAACCTCCCACCACTAGCAAACGGTTTGAGGTGGAAGATATGGTGAAAAGTGTTTTTCTTTATATCAATATTCAATATTACCACTATCCCTAA

>Glyma08g40480.1   sequence type=predicted peptide   gene model=Glyma08g40480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVPTSYLKIKSPTPYIFRNSSELQYGMNFAHGGTGIFNTLVDGPNMTSILKLTLKAQVALVNAAGNDYATFLLRKLGSIQIDQYDDDYPKLFLNLFYRRWFSPKLSSYQIRFWYNPGCPSIIKIFIYSSFFFSFCTMTAMRIEARYPHASIKPPTTSKRFEVEDMVKSVFLYINIQYYHYP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo