Glyma08g40260 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g40260

Feature Type:	gene_model
Chromosome:	Gm08
Start:	39960109
stop:	39962316
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g40260

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G14920	AT	Annotation by Michelle Graham. TAIR10: Gibberellin-regulated family protein \| chr5:4826598-4827761 FORWARD LENGTH=275	SoyBase	E_val: 2.00E-20	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF02704	PFAM	Gibberellin regulated protein	JGI		ISS
UniRef100_C6SWB6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWB6_SOYBN	SoyBase	E_val: 3.00E-78	ISS
UniRef100_G7LER1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin-regulated protein n=1 Tax=Medicago truncatula RepID=G7LER1_MEDTR	SoyBase	E_val: 7.00E-50	ISS

Expression Patterns of Glyma08g40260

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g40260

Paralog	Evidence	Comments
Glyma18g17490	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g40260 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g291900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g40260

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g40260

Limit To All Plant Sequences

>Glyma08g40260.1   sequence type=CDS   gene model=Glyma08g40260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAACAAAAGGAAGACTTTACTATTGCTGCTGCTCATGGCTGCAACTCTCTTTTGCATGCCAATTGTGTCGTATGCTGTTTCTAATGTCAACATTCAAGACCATCTCACCAATATTTCTGAGCTGGTAAAAGGTCCAAATAGAAGGCTTTTGTCATTTGTGGATTGTGGAGAGAGGTGCAGGGTGAGGTGCAGTTTGCACTCAAGGCCAAAGATTTGCACGAGAGCTTGCGGGACATGCTGTATGAGGTGCAGGTGTGTTCCTCCGGGCACTTACGGGAACAGAGAGATGTGTGGCAAGTGTTACACTCACATGATCACTCATGGCAACAAACCTAAGTGCCCCTAA

Predicted protein sequences of Glyma08g40260

Limit To All Plant Sequences

>Glyma08g40260.1   sequence type=predicted peptide   gene model=Glyma08g40260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKNKRKTLLLLLLMAATLFCMPIVSYAVSNVNIQDHLTNISELVKGPNRRLLSFVDCGERCRVRCSLHSRPKICTRACGTCCMRCRCVPPGTYGNREMCGKCYTHMITHGNKPKCP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain