Glyma08g40200 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g40200

Feature Type:	gene_model
Chromosome:	Gm08
Start:	39910961
stop:	39911815
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g40200

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G14342	AT	Annotation by Michelle Graham. TAIR10: Splicing factor 3B subunit 5/RDS3 complex subunit 10 \| chr4:8253789-8255405 REVERSE LENGTH=87	SoyBase	E_val: 7.00E-46	ISS
GO:0000398	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG3485	KOG	Uncharacterized conserved protein	JGI		ISS
PTHR20978	Panther	FAMILY NOT NAMED	JGI		ISS
PF07189	PFAM	Splicing factor 3B subunit 10 (SF3b10)	JGI		ISS
UniRef100_E5GC24	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Splicing factor 3b subunit n=1 Tax=Cucumis melo subsp. melo RepID=E5GC24_CUCME	SoyBase	E_val: 2.00E-43	ISS
UniRef100_I1KXK6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KXK6_SOYBN	SoyBase	E_val: 5.00E-46	ISS

Expression Patterns of Glyma08g40200

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g40200

Paralog	Evidence	Comments
Glyma18g17590	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g40200 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g291500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g40200

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g40200

Limit To All Plant Sequences

>Glyma08g40200.3   sequence type=CDS   gene model=Glyma08g40200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGCCAGTGATAGGTTTAACATCAATTCCCAGCTTGAGCATCTCCAAGCCAAATATGTTGGAACTGGCCATGCCGATTTGAACAGATTTGAGTGGGCAGTGAACATTCAACGAGATAGCTATGCATCATATATTGGACACTACCCTTTACTGGGATTCTTTGCTATTGCTGAAAATGAATCTATTGGAAGAGAACGCTACAGCTTTATGCAGGTTGTGTATGGGTTTTTATGA

Predicted protein sequences of Glyma08g40200

Limit To All Plant Sequences

>Glyma08g40200.3   sequence type=predicted peptide   gene model=Glyma08g40200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQASDRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYIGHYPLLGFFAIAENESIGRERYSFMQVVYGFL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain