SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g40200

Feature Type:gene_model
Chromosome:Gm08
Start:39910961
stop:39911815
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G14342AT Annotation by Michelle Graham. TAIR10: Splicing factor 3B subunit 5/RDS3 complex subunit 10 | chr4:8253789-8255405 REVERSE LENGTH=87 SoyBaseE_val: 7.00E-46ISS
GO:0000398GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3485 KOG Uncharacterized conserved protein JGI ISS
PTHR20978Panther FAMILY NOT NAMED JGI ISS
PF07189PFAM Splicing factor 3B subunit 10 (SF3b10) JGI ISS
UniRef100_E5GC24UniRef Annotation by Michelle Graham. Most informative UniRef hit: Splicing factor 3b subunit n=1 Tax=Cucumis melo subsp. melo RepID=E5GC24_CUCME SoyBaseE_val: 2.00E-43ISS
UniRef100_I1KXK6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KXK6_SOYBN SoyBaseE_val: 5.00E-46ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g17590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g291500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g40200.3   sequence type=CDS   gene model=Glyma08g40200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGCCAGTGATAGGTTTAACATCAATTCCCAGCTTGAGCATCTCCAAGCCAAATATGTTGGAACTGGCCATGCCGATTTGAACAGATTTGAGTGGGCAGTGAACATTCAACGAGATAGCTATGCATCATATATTGGACACTACCCTTTACTGGGATTCTTTGCTATTGCTGAAAATGAATCTATTGGAAGAGAACGCTACAGCTTTATGCAGGTTGTGTATGGGTTTTTATGA

>Glyma08g40200.3   sequence type=predicted peptide   gene model=Glyma08g40200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQASDRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYIGHYPLLGFFAIAENESIGRERYSFMQVVYGFL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo