SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g40110

Feature Type:gene_model
Chromosome:Gm08
Start:39808658
stop:39811001
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g40110
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G11400AT Annotation by Michelle Graham. TAIR10: eukaryotic translation initiation factor 3G1 | chr3:3578536-3580366 FORWARD LENGTH=294 SoyBaseE_val: 1.00E-153ISS
GO:0000398GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome SoyBaseN/AISS
GO:0006413GO-bp Annotation by Michelle Graham. GO Biological Process: translational initiation SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005852GO-cc Annotation by Michelle Graham. GO Cellular Compartment: eukaryotic translation initiation factor 3 complex SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003743GO-mf Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
KOG0122 KOG Translation initiation factor 3, subunit g (eIF-3g) JGI ISS
PTHR10352Panther EUKARYOTIC TRANSLATION INITIATION FACTOR 3 JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
PF12353PFAM Eukaryotic translation initiation factor 3 subunit G JGI ISS
UniRef100_I1KXJ9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 3 subunit G n=1 Tax=Glycine max RepID=I1KXJ9_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1KXJ9UniRef Annotation by Michelle Graham. Best UniRef hit: Eukaryotic translation initiation factor 3 subunit G n=1 Tax=Glycine max RepID=I1KXJ9_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma08g40110
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g40110
ParalogEvidenceComments
Glyma18g18050 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g40110 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g290700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g40110
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g40110
>Glyma08g40110.1   sequence type=CDS   gene model=Glyma08g40110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCATCAAGGAGAACCGGCGAAGCTGCGATGGGGAGAGCTGGAGGAGGACGACGGAGAGGATTTGGACTTCCTCCTGCCGCCGCGGCAGGTGATAGGGCCCGACGAGAACGGGATAAAGAAGGTGATCGAGTACAAGTTCGACGAGGACGGGAACAAGGTAAAGATCACCACCACCACACGCACGCGCAAACTCGCCAACGCGCGTCTCAGCAAACGCGCCATCGAGCGCCGCTCCTGGCCCAAGTTCGGCGACGCCGTACACGAAGACGTCGGCGCCCGCCTCACCATGGTCTCCACCGAAGAGATCCTCCTCGAACGCCCCAAGCCTCTTGGTGCCAAGACAGAGGAGCCAAAGAATGCTGGAGACCCATTGGCTCAATTTCAGAAAGGTGCTGTTCTCATGGTCTGTAGGACTTGTGGGAAGAAGGGTGATCACTGGACCTCAAGGTGTCCATACAAGGATCTTGCCCCGCCATCTGAGGGATTCATCGATAAACCTGCGGCCGCGGATGCTGGTGCGGCCGCTGCTGGTGCAACCAAGGGAGCATATGTGCCTCCTGGTATGAGGGCAGGTGCTGAGAGGACTACTGGATCTGATATGCGACGCAGGAATGATGAGAACTCTGTGAGAGTAACTAACCTCTCTGAGGACACAAGAGAGCCTGATTTGCTGGAGCTGTTCCGTCCTTTCGGCCCTGTCAGCAGAGTCTATGTTGCCATTGATCAGAAGACTGGCATGAGCAGAGGGTTTGGCTTTGTTAACTTTGTCAACAGGGAAGATGCACAAAGAGCCATCGGCAAGCTCAATGGTTATGGCTATGACAATCTCATCCTTAGAGTTGAATGGGCAACCCCAAGAGCAAATTAA
Predicted protein sequences of Glyma08g40110
>Glyma08g40110.1   sequence type=predicted peptide   gene model=Glyma08g40110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAHQGEPAKLRWGELEEDDGEDLDFLLPPRQVIGPDENGIKKVIEYKFDEDGNKVKITTTTRTRKLANARLSKRAIERRSWPKFGDAVHEDVGARLTMVSTEEILLERPKPLGAKTEEPKNAGDPLAQFQKGAVLMVCRTCGKKGDHWTSRCPYKDLAPPSEGFIDKPAAADAGAAAAGATKGAYVPPGMRAGAERTTGSDMRRRNDENSVRVTNLSEDTREPDLLELFRPFGPVSRVYVAIDQKTGMSRGFGFVNFVNREDAQRAIGKLNGYGYDNLILRVEWATPRAN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo