Report for Sequence Feature Glyma08g39980
Feature Type: gene_model
Chromosome: Gm08
Start: 39666944
stop: 39667741
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g39980
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_G7LG50 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Thermosensitive gluconokinase n=1 Tax=Medicago truncatula RepID=G7LG50_MEDTR
SoyBase E_val: 1.00E-11 ISS
UniRef100_UPI00023386FF UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI00023386FF related cluster n=1 Tax=unknown RepID=UPI00023386FF
SoyBase E_val: 7.00E-47 ISS
Expression Patterns of Glyma08g39980
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma08g39980 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g289700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g39980
Coding sequences of Glyma08g39980
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g39980.1 sequence type=CDS gene model=Glyma08g39980 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCATTTTCTCATCTCTGCATCCCAATCCAATAGATCAATATGGCTTCAAACAACGCACAATAGGTTGGAGAGGCTGGAAAAAGAGATGAAATACAAGTATCTTCATGCTGATGATTCTCATTCTGAATCAAACAAAGAAAAGATGTGTATGGGAATCCCACTTACAGATGAAGACCGATGCCATGGCTTGAATCACTACATCTACGTGATACCATAA
Predicted protein sequences of Glyma08g39980
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g39980.1 sequence type=predicted peptide gene model=Glyma08g39980 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MHFLISASQSNRSIWLQTTHNRLERLEKEMKYKYLHADDSHSESNKEKMCMGIPLTDEDRCHGLNHYIYVIP*