SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g39980

Feature Type:gene_model
Chromosome:Gm08
Start:39666944
stop:39667741
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
UniRef100_G7LG50UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thermosensitive gluconokinase n=1 Tax=Medicago truncatula RepID=G7LG50_MEDTR SoyBaseE_val: 1.00E-11ISS
UniRef100_UPI00023386FFUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023386FF related cluster n=1 Tax=unknown RepID=UPI00023386FF SoyBaseE_val: 7.00E-47ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g289700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g39980.1   sequence type=CDS   gene model=Glyma08g39980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATTTTCTCATCTCTGCATCCCAATCCAATAGATCAATATGGCTTCAAACAACGCACAATAGGTTGGAGAGGCTGGAAAAAGAGATGAAATACAAGTATCTTCATGCTGATGATTCTCATTCTGAATCAAACAAAGAAAAGATGTGTATGGGAATCCCACTTACAGATGAAGACCGATGCCATGGCTTGAATCACTACATCTACGTGATACCATAA

>Glyma08g39980.1   sequence type=predicted peptide   gene model=Glyma08g39980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHFLISASQSNRSIWLQTTHNRLERLEKEMKYKYLHADDSHSESNKEKMCMGIPLTDEDRCHGLNHYIYVIP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo