SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g39510): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g39510): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g39510

Feature Type:gene_model
Chromosome:Gm08
Start:39045506
stop:39051710
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G14740AT Annotation by Michelle Graham. TAIR10: carbonic anhydrase 2 | chr5:4760536-4762382 FORWARD LENGTH=259 SoyBaseE_val: 2.00E-131ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009814GO-bp Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015976GO-bp Annotation by Michelle Graham. GO Biological Process: carbon utilization SoyBaseN/AISS
GO:0019243GO-bp Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004089GO-mf Annotation by Michelle Graham. GO Molecular Function: carbonate dehydratase activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
KOG1578 KOG Predicted carbonic anhydrase involved in protection against oxidative damage JGI ISS
PTHR11002Panther CARBONIC ANHYDRASE JGI ISS
PTHR11002:SF1Panther CARBONIC ANHYDRASE-RELATED JGI ISS
PF00484PFAM Carbonic anhydrase JGI ISS
UniRef100_I1KXF9UniRef Annotation by Michelle Graham. Best UniRef hit: Carbonic anhydrase n=2 Tax=Glycine max RepID=I1KXF9_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1KXF9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Carbonic anhydrase n=2 Tax=Glycine max RepID=I1KXF9_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g39510 not represented in the dataset

Glyma08g39510 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g19080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g286700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g39510.2   sequence type=CDS   gene model=Glyma08g39510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGGAGGATCATACGAGGAAGCCATTGCAGCGTTGACGAAGCTTCTCAGCGAGAAAGCCGACCTGGGTGGTGTCGCCGCCGCAAAGATAAAACAGCTGACGGCGGAGCTGGATACCGCCACCGCAAACGGGTCGACGCCGTTTAACCCGGACGAGAGGATCCGAACCGGGTTCGCCCACTTCAAGAACGAGAAATACCAGAAGAACCCGGAATTATATGGCGAACTTGCCAAAGGCCAGAGTCCAAAGTTTATGGTTTTTGCTTGCTCAGACTCTCGAGTTTGCCCATCCCACATTCTGGATTTCAATCCGGGTGAAGCCTTTGTGGTCCGAAATATCGCCAACATGGTTCCACCATATGACAAGACCAAGTATTCAGGAACCGGGGCGGCCATTGAATATGCAGTCTTACATTTAAAGGTGGAGAATATTGTGGTCATTGGGCACAGCTGCTGTGGAGGTATAAAGGGCCTAATGTCTATCCCAGATGATGGGACCACTGCAAGTGAATTCATAGAGCACTGGGTCCAAATTTGCACTCCAGCAAAGTCCAAGGTTAAAACAGAAGCAAACACATTAGAATTCTCTGAGCAATGTACCAGCTGCGAGAAGGAAGCTGTGAATGTATCACTTGGGAACCTATTGACATATCGATTTGTGAGAGATGCAGTTGTGAAGAAAACTCTTGCCTTGAAAGGTGCACATTACAATTTCGTTAAGGGCACATTTGAGCTGTGGGATCTGGACTTGAAAATCTCTAACTCTGTATCCGTTTAA

>Glyma08g39510.2   sequence type=predicted peptide   gene model=Glyma08g39510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGGSYEEAIAALTKLLSEKADLGGVAAAKIKQLTAELDTATANGSTPFNPDERIRTGFAHFKNEKYQKNPELYGELAKGQSPKFMVFACSDSRVCPSHILDFNPGEAFVVRNIANMVPPYDKTKYSGTGAAIEYAVLHLKVENIVVIGHSCCGGIKGLMSIPDDGTTASEFIEHWVQICTPAKSKVKTEANTLEFSEQCTSCEKEAVNVSLGNLLTYRFVRDAVVKKTLALKGAHYNFVKGTFELWDLDLKISNSVSV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo