SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g39360

Feature Type:gene_model
Chromosome:Gm08
Start:38897036
stop:38900864
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g39360
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G10630AT Annotation by Michelle Graham. TAIR10: ADP-ribosylation factor A1F | chr1:3513189-3514230 REVERSE LENGTH=181 SoyBaseE_val: 7.00E-132ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
GO:0016004GO-mf Annotation by Michelle Graham. GO Molecular Function: phospholipase activator activity SoyBaseN/AISS
KOG0070 KOG GTP-binding ADP-ribosylation factor Arf1 JGI ISS
PTHR11711Panther ARF-RELATED JGI ISS
PF00025PFAM ADP-ribosylation factor family JGI ISS
UniRef100_G8FGM3UniRef Annotation by Michelle Graham. Best UniRef hit: ADP-ribosylation factor n=1 Tax=Elaeis guineensis RepID=G8FGM3_ELAGV SoyBaseE_val: 8.00E-131ISS
UniRef100_G8FGM3UniRef Annotation by Michelle Graham. Most informative UniRef hit: ADP-ribosylation factor n=1 Tax=Elaeis guineensis RepID=G8FGM3_ELAGV SoyBaseE_val: 8.00E-131ISS

Expression Patterns of Glyma08g39360
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g39360
ParalogEvidenceComments
Glyma18g19420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g39360 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g285600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g39360
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g39360
>Glyma08g39360.1   sequence type=CDS   gene model=Glyma08g39360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTTGACATTCACCAAGCTTTTCAGCCGGCTTTTCGCCAAGAAGGAAATGCGAATTCTGATGGTGGGTCTCGATGCAGCTGGTAAGACCACCATCCTGTACAAGCTCAAACTTGGAGAGATCGTTACCACAATTCCCACCATTGGGTTCAATGTGGAGACTGTGGAATACAAGAACATTAGTTTCACTGTCTGGGATGTTGGTGGCCAGGACAAGATTCGTCCCTTGTGGAGGCACTACTTCCAAAACACACAGGGTCTCATTTTTGTGGTTGACAGCAACGACAGGGACAGAGTTGTTGAGGCCAGAGATGAGTTGCACAGGATGTTGAATGAGGATGAACTGAGAGATGCAGTATTGCTCGTATTTGCTAACAAACAAGATCTTCCCAATGCAATGAATGCTGCTGAAATTACCGACAAGCTGGGTCTCCACTCTCTCAGACAGCGCCACTGGTACATCCAGAGCACCTGCGCAACCTCTGGGGAGGGTCTTTATGAGGGTTTGGACTGGCTTTCCAACAACATAGCCAACAAGGCTTGA
Predicted protein sequences of Glyma08g39360
>Glyma08g39360.1   sequence type=predicted peptide   gene model=Glyma08g39360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo