Glyma08g39280 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g39280

Feature Type:	gene_model
Chromosome:	Gm08
Start:	38792320
stop:	38793918
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g39280

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G10657	AT	Annotation by Michelle Graham. TAIR10: Plant protein 1589 of unknown function \| chr1:3530652-3531522 FORWARD LENGTH=101	SoyBase	E_val: 2.00E-33	ISS
PF09713	PFAM	Plant protein 1589 of unknown function (A thal 3526)	JGI		ISS
UniRef100_I1KXD5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KXD5_SOYBN	SoyBase	E_val: 2.00E-70	ISS
UniRef100_Q1G3V6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT1G10657 protein n=2 Tax=Arabidopsis thaliana RepID=Q1G3V6_ARATH	SoyBase	E_val: 9.00E-31	ISS

Expression Patterns of Glyma08g39280

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g39280

Paralog	Evidence	Comments
Glyma18g19730	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g39280 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g285100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g39280

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g39280

Limit To All Plant Sequences

>Glyma08g39280.1   sequence type=CDS   gene model=Glyma08g39280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATGATCACAGTCATCAATACCCTCTTCCTTGTTTGTATTGCCACCCTTATAGCTATATTAGGATGGTTCAAAATCTCATAGAGAGATGCATGCTCTTTCACATGAGCCAAGACCAGTGCATAAGGGCACTGGCAGAACATGCAGGGATTAAGCCACTTGTTACTGTTACAGTGTGGAAAGAGTTGCAAAAGGAGAACAAGGAGTTCTTTCGAGCATATTTGCAAGTTGTCACTCCCAGGCCATTATTCATGAGTAGATGTTTTCAAAGGAGACCAAATTTGGCAAGAAGGAAACACTGGAAATGA

Predicted protein sequences of Glyma08g39280

Limit To All Plant Sequences

>Glyma08g39280.1   sequence type=predicted peptide   gene model=Glyma08g39280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHDHSHQYPLPCLYCHPYSYIRMVQNLIERCMLFHMSQDQCIRALAEHAGIKPLVTVTVWKELQKENKEFFRAYLQVVTPRPLFMSRCFQRRPNLARRKHWK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain