Glyma08g39170 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g39170

Feature Type:	gene_model
Chromosome:	Gm08
Start:	38589038
stop:	38598083
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g39170

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G23380	AT	Annotation by Michelle Graham. TAIR10: KNOTTED1-like homeobox gene 6 \| chr1:8297499-8302492 REVERSE LENGTH=327	SoyBase	E_val: 4.00E-147	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009062	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process	SoyBase	N/A	ISS
GO:0009855	GO-bp	Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry	SoyBase	N/A	ISS
GO:0010014	GO-bp	Annotation by Michelle Graham. GO Biological Process: meristem initiation	SoyBase	N/A	ISS
GO:0010073	GO-bp	Annotation by Michelle Graham. GO Biological Process: meristem maintenance	SoyBase	N/A	ISS
GO:0048513	GO-bp	Annotation by Michelle Graham. GO Biological Process: organ development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
KOG0773	KOG	Transcription factor MEIS1 and related HOX domain proteins	JGI		ISS
PTHR11850	Panther	HOMEOBOX PROTEIN	JGI		ISS
PTHR11850:SF49	Panther	PRE-B-CELL LEUKEMIA TRANSCRIPTION FACTOR 4	JGI		ISS
PF00046	PFAM	Homeobox domain	JGI		ISS
PF03789	PFAM	ELK domain	JGI		ISS
PF03790	PFAM	KNOX1 domain	JGI		ISS
PF03791	PFAM	KNOX2 domain	JGI		ISS
UniRef100_G7K060	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Knotted-1 homeobox protein n=1 Tax=Medicago truncatula RepID=G7K060_MEDTR	SoyBase	E_val: 3.00E-167	ISS
UniRef100_I1KXC9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KXC9_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma08g39170

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g39170

Paralog	Evidence	Comments
Glyma18g20293	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g39170 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g284300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g39170

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g39170

Limit To All Plant Sequences

>Glyma08g39170.1   sequence type=CDS   gene model=Glyma08g39170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGACGAAATGTACGGCGTGTCGTCCACGACGGAGTACTCGGACGGGGCGCTGATGACGCCGGAGAACATATTCCCGGCGGAGTACCACAGCTTCCTAATGTCCTCCGCCGCCCGGATTCCGATGTTCGGATCCGACGAGCTTCTCTCCGCCGTCACCGCCGGCAACGAAACCGAACCCTACCCTGGCGCCACCATCGCACCGGAAATTCAGCGCCAAAACGACGCCTCCTCTCTCATCAAAGCCAAAATCGCCTCTCACCCTCACTACCCTCGCCTTCTCCAAGCCTACATCGATTGCCAGAAGGTGGGAGCGCCTCCAGAAATCGCGTGTTTGTTAGAGGAAATCCGACGAGAAAACGACGTTTGCAAGAGAGACGTTGTTGTTTCCACGTGCGTTGAAGCCGATCCCGAACTCGACGAGTTCATGGAAACCTACTGTGACATGCTGGTGAAATACAAATCTGATCTGACGCGGCCTTTTGACGAAGCCACCACCTTCCTCAACAAGATCGAAACTCAGCTTACCGATCTCTGCAGTGGTTCTTCTCTTCTAACACTTTCCGATGATGGGGGTGTATCTTCAGAAGAAGGTTTTAGTGCTGGAGATGGTGATCCTCAAGATGGCCAATTACGGAGTGAAGATCGAGAGCTGAAGGATAGGCTTTTACGCAAGTTTGGAAGTCACATTGGTTATTTGAAATTGGAATTTTCAAAGAAGAAAAAGAGGGGTAAGCTGCCCAAAGACGCAAGGCAAACACTACTTCAATGGTGGAATATTCACTACAAATGGCCATACCCTACGGAAGGTGATAAGATTGCACTGGCTAAATCAACTGGGTTAGACCAGAAGCAAATTAACAACTGGTTTATTAATCAGAGAAAGCGTCACTGGAAACCATCTGAGAACATGCCGTTCTCTATGGTGGATGGTCTCACCGGTCGGTTCCTTACTGATGAATGA

Predicted protein sequences of Glyma08g39170

Limit To All Plant Sequences

>Glyma08g39170.1   sequence type=predicted peptide   gene model=Glyma08g39170   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEDEMYGVSSTTEYSDGALMTPENIFPAEYHSFLMSSAARIPMFGSDELLSAVTAGNETEPYPGATIAPEIQRQNDASSLIKAKIASHPHYPRLLQAYIDCQKVGAPPEIACLLEEIRRENDVCKRDVVVSTCVEADPELDEFMETYCDMLVKYKSDLTRPFDEATTFLNKIETQLTDLCSGSSLLTLSDDGGVSSEEGFSAGDGDPQDGQLRSEDRELKDRLLRKFGSHIGYLKLEFSKKKKRGKLPKDARQTLLQWWNIHYKWPYPTEGDKIALAKSTGLDQKQINNWFINQRKRHWKPSENMPFSMVDGLTGRFLTDE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain