Glyma08g39080 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g39080

Feature Type:	gene_model
Chromosome:	Gm08
Start:	38332261
stop:	38342922
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g39080

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G60780	AT	Annotation by Michelle Graham. TAIR10: Clathrin adaptor complexes medium subunit family protein \| chr1:22369289-22371885 REVERSE LENGTH=428	SoyBase	E_val: 0	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0030125	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: clathrin vesicle coat	SoyBase	N/A	ISS
GO:0030131	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: clathrin adaptor complex	SoyBase	N/A	ISS
KOG0937	KOG	Adaptor complexes medium subunit family	JGI		ISS
PTHR11998	Panther	CLATHRIN COAT ASSEMBLY PROTEIN	JGI		ISS
PTHR11998:SF11	Panther	CLATHRIN COAT ASSEMBLY PROTEIN	JGI		ISS
PF00928	PFAM	Adaptor complexes medium subunit family	JGI		ISS
PF01217	PFAM	Clathrin adaptor complex small chain	JGI		ISS
UniRef100_G7K043	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AP-1 complex subunit mu n=1 Tax=Medicago truncatula RepID=G7K043_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_I1KXB9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KXB9_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma08g39080

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g39080

Paralog	Evidence	Comments
Glyma18g20720	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g39080 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g283400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g39080

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g39080

Limit To All Plant Sequences

>Glyma08g39080.1   sequence type=CDS   gene model=Glyma08g39080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGGGGCAGCCTCTGCTCTGTTCCTCCTTGACATCAAAGGCCGCGTCCTCATCTGGCGCGACTACCGCGGTGACGTCACCGCCGTCGAAGCTGAACGCTTCTTCACCAAACTCATCGAAAAAGAGGGGGATCCGCAGTCTCAAGATCCGGTTGTGTATGATAATGGTGTGACCTACTTGTTTATACAGCATAGCAATGTTTTCCTCATGATGGCTACCAGACAAAACTGCAATGCTGCTAGCCTCCTTTTCTTCCTACACCGTATCGTTGACGTGTTTAAGCATTATTTTGAAGAATTGGAAGAGGAGTCTCTTAGGGATAACTTTGTTGTTGTGTATGAATTACTTGATGAAATAATGGACTTTGGCTACCCGCAATACACTGAGGCAAAGATTCTTAGTGAGTTTATCAAGACGGATGCCTATAGAATGGAAGTTACACAGAGACCTCCCATGGCTGTGACAAATGCTGTATCCTGGCGCAGTGAAGGGATAAACTACAAGAAAAATGAGGTTTTCTTGGATGTGGTGGAGAGTGTTAACATACTTGTCAATAGCAATGGACAAATAATTAGGTCTGATGTTGTTGGGGCATTGAAGATGAGAACATATCTGAGTGGTATGCCTGAGTGTAAACTTGGATTAAATGATAGAGTATTATTAGAGGCACAAGGTAGAACAACCAAGGGAAAATCAATTGACTTGGAAGACATCAAATTTCATCAGTGTGTGCGTTTGGCCCGATTTGAGAATGATCGAACGATTTCATTTATCCCTCCTGATGGATCATTTGATTTAATGACATATAGGCTCAGTACACAGGTTAAGCCTTTAGTTTGGGTGGAAGCACAAGTTGAAAAACATTCAAAAAGCCGGATCGAGATTATGGTAAAAGCTAGGAGTCAATTTAAGGAACGCAGTACTGCCACAAATGTTGAGATTGAGTTGCCTGTTCCTGCTGATGCAACCAATCCAAATGTTCGGACTTCAATGGGATCTGCATCATATGCACCTGAAAAAGATGCATTAATCTGGAAAATAAGATCATTTCCTGGAGGAAAGGAGTACATGTTAAGGGCAGAGTTTCATCTTCCCAGTATAGTAGATGAGGAAGCAACTCCTGAGAGAAAAGCTCCTATACGTGTAAAATTTGAGATACCATATTTTACTGTGTCTGGGATACAGGTAAGATATTTGAAGATTATTGAGAAAAGTGGTTATCAGGCTCTTCCATGGGTGAGATACATAACAATGGCTGGAGAGTATGAACTGAGGCTCATTTGA

Predicted protein sequences of Glyma08g39080

Limit To All Plant Sequences

>Glyma08g39080.1   sequence type=predicted peptide   gene model=Glyma08g39080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGAASALFLLDIKGRVLIWRDYRGDVTAVEAERFFTKLIEKEGDPQSQDPVVYDNGVTYLFIQHSNVFLMMATRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNILVNSNGQIIRSDVVGALKMRTYLSGMPECKLGLNDRVLLEAQGRTTKGKSIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLVWVEAQVEKHSKSRIEIMVKARSQFKERSTATNVEIELPVPADATNPNVRTSMGSASYAPEKDALIWKIRSFPGGKEYMLRAEFHLPSIVDEEATPERKAPIRVKFEIPYFTVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYELRLI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain