SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g38880

Feature Type:gene_model
Chromosome:Gm08
Start:38119572
stop:38120141
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g38880
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G34440AT Annotation by Michelle Graham. TAIR10: AGAMOUS-like 29 | chr2:14526950-14527468 FORWARD LENGTH=172 SoyBaseE_val: 6.00E-34ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
UniRef100_G7JGR6UniRef Annotation by Michelle Graham. Most informative UniRef hit: MADS-box transcription factor n=1 Tax=Medicago truncatula RepID=G7JGR6_MEDTR SoyBaseE_val: 6.00E-58ISS
UniRef100_I1KXB3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KXB3_SOYBN SoyBaseE_val: 3.00E-116ISS

Expression Patterns of Glyma08g38880
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g38880
ParalogEvidenceComments
Glyma18g20830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g38880 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g282500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g38880
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g38880
>Glyma08g38880.2   sequence type=CDS   gene model=Glyma08g38880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCGTCGTAAGATTGAAATTGCGGAGGTGAAAGACCCTAATACGAGGCAAGTCACATTTTCCAAGCGTCGATCAGGCTTATTCAAAAAGGCAAATGAATTGTCCATCTTGTGCGGAGTAGAAATTGCTATGGTTGTGTTCTCTATTGGAAACAAACCTTATTCTTTTGGGCACCCAAGTGTTGATGTTGTTGCAACCAAGTTTCTTCAACAAGCGACAACCAATTCAAATGATGATGCACAGGGAAAAAATAACAACAACCCTAATTCGAATGAAGTTGTTGATGGTGACAACATGGAAAGGTTGAATCAACAATTGTCTAATCTTCAGGCCCAAATACTAGAGGAAGAAAAGAAGGGTGCGAGGCATGATGAGAGACTAAAACAACATGAAGTGACACAAGTCTCTCAATATGCAGAATTGCAAGGTTCTTGTTTAGAGCTCCAACGTAAGGTGAAGGACAATGTTGACGCAATCGAGGTATCAGAGTGTATGTTGCTTCTTGCAAAAGAACCCGTAGTCGGAGTAAGAAAACAAATGACTACGAAGAAAAGAAGAAAGAATTGA
Predicted protein sequences of Glyma08g38880
>Glyma08g38880.2   sequence type=predicted peptide   gene model=Glyma08g38880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRRKIEIAEVKDPNTRQVTFSKRRSGLFKKANELSILCGVEIAMVVFSIGNKPYSFGHPSVDVVATKFLQQATTNSNDDAQGKNNNNPNSNEVVDGDNMERLNQQLSNLQAQILEEEKKGARHDERLKQHEVTQVSQYAELQGSCLELQRKVKDNVDAIEVSECMLLLAKEPVVGVRKQMTTKKRRKN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo