Glyma08g38460 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g38460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g38460): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g38460

Feature Type:	gene_model
Chromosome:	Gm08
Start:	37568645
stop:	37569961
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g38460

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G03300	AT	Annotation by Michelle Graham. TAIR10: adenosine kinase 2 \| chr5:796573-798997 FORWARD LENGTH=345	SoyBase	E_val: 2.00E-20	ISS
GO:0006166	GO-bp	Annotation by Michelle Graham. GO Biological Process: purine ribonucleoside salvage	SoyBase	N/A	ISS
GO:0006169	GO-bp	Annotation by Michelle Graham. GO Biological Process: adenosine salvage	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004001	GO-mf	Annotation by Michelle Graham. GO Molecular Function: adenosine kinase activity	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016773	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, alcohol group as acceptor	SoyBase	N/A	ISS
UniRef100_G7IAA2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Adenosine kinase n=1 Tax=Medicago truncatula RepID=G7IAA2_MEDTR	SoyBase	E_val: 9.00E-19	ISS
UniRef100_UPI0002339339	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339339 related cluster n=1 Tax=unknown RepID=UPI0002339339	SoyBase	E_val: 5.00E-22	ISS

Expression Patterns of Glyma08g38460

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g38460 not represented in the dataset	Glyma08g38460 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g38460 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g280800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g38460

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g38460

Limit To All Plant Sequences

>Glyma08g38460.1   sequence type=CDS   gene model=Glyma08g38460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAAACAACCACATCTGGTGATGTTATTACTGTAATTTTTCAGATTGAAATGGGAGATTTATTTATTGGATGTCTCTCAACAGGTGATTTCATTTGGTCGAAATTAAAGGATTTACAATATGGTATAAGGAGCAAACTTGGTGTGTATTTTTCCCTCCTATATTGTATATTCTATTCCTGTATGCAAATCTTCATGATGAACCTTTCTACTACCTTTATCTGTGAGTTCTCCAAGGATATATGGACTACGTTTTTGGAAATGAGACTGAAGCAAGAACATTTTCTAAAGCTCAAGGCTGGGAGCTTTGAAGATTTCTCACTTGCCAAAAGCATCATAAAACATAAAAGGATTACCGTTATCACCCAAGGTGCAGATCCTGTTTGTGTTGTTGAGAGTGGGAAAATGAAATTGTACCTTGTGATACTATTACCTAAAGACAAATTAGTTGATACAAATGGAGCAGTTTACAATAACAATTTAATTATATTTAAAATTAATTTTAAATGGCCTAAGATTATAATTTTATGA

Predicted protein sequences of Glyma08g38460

Limit To All Plant Sequences

>Glyma08g38460.1   sequence type=predicted peptide   gene model=Glyma08g38460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KTTTSGDVITVIFQIEMGDLFIGCLSTGDFIWSKLKDLQYGIRSKLGVYFSLLYCIFYSCMQIFMMNLSTTFICEFSKDIWTTFLEMRLKQEHFLKLKAGSFEDFSLAKSIIKHKRITVITQGADPVCVVESGKMKLYLVILLPKDKLVDTNGAVYNNNLIIFKINFKWPKIIIL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain