SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g38460

Feature Type:gene_model
Chromosome:Gm08
Start:37568645
stop:37569961
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g38460
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03300AT Annotation by Michelle Graham. TAIR10: adenosine kinase 2 | chr5:796573-798997 FORWARD LENGTH=345 SoyBaseE_val: 2.00E-20ISS
GO:0006166GO-bp Annotation by Michelle Graham. GO Biological Process: purine ribonucleoside salvage SoyBaseN/AISS
GO:0006169GO-bp Annotation by Michelle Graham. GO Biological Process: adenosine salvage SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004001GO-mf Annotation by Michelle Graham. GO Molecular Function: adenosine kinase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016773GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, alcohol group as acceptor SoyBaseN/AISS
UniRef100_G7IAA2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Adenosine kinase n=1 Tax=Medicago truncatula RepID=G7IAA2_MEDTR SoyBaseE_val: 9.00E-19ISS
UniRef100_UPI0002339339UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339339 related cluster n=1 Tax=unknown RepID=UPI0002339339 SoyBaseE_val: 5.00E-22ISS

Expression Patterns of Glyma08g38460
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g38460 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g280800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g38460
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g38460
>Glyma08g38460.1   sequence type=CDS   gene model=Glyma08g38460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAAACAACCACATCTGGTGATGTTATTACTGTAATTTTTCAGATTGAAATGGGAGATTTATTTATTGGATGTCTCTCAACAGGTGATTTCATTTGGTCGAAATTAAAGGATTTACAATATGGTATAAGGAGCAAACTTGGTGTGTATTTTTCCCTCCTATATTGTATATTCTATTCCTGTATGCAAATCTTCATGATGAACCTTTCTACTACCTTTATCTGTGAGTTCTCCAAGGATATATGGACTACGTTTTTGGAAATGAGACTGAAGCAAGAACATTTTCTAAAGCTCAAGGCTGGGAGCTTTGAAGATTTCTCACTTGCCAAAAGCATCATAAAACATAAAAGGATTACCGTTATCACCCAAGGTGCAGATCCTGTTTGTGTTGTTGAGAGTGGGAAAATGAAATTGTACCTTGTGATACTATTACCTAAAGACAAATTAGTTGATACAAATGGAGCAGTTTACAATAACAATTTAATTATATTTAAAATTAATTTTAAATGGCCTAAGATTATAATTTTATGA
Predicted protein sequences of Glyma08g38460
>Glyma08g38460.1   sequence type=predicted peptide   gene model=Glyma08g38460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KTTTSGDVITVIFQIEMGDLFIGCLSTGDFIWSKLKDLQYGIRSKLGVYFSLLYCIFYSCMQIFMMNLSTTFICEFSKDIWTTFLEMRLKQEHFLKLKAGSFEDFSLAKSIIKHKRITVITQGADPVCVVESGKMKLYLVILLPKDKLVDTNGAVYNNNLIIFKINFKWPKIIIL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo