Glyma08g38430 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g38430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g38430): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g38430

Feature Type:	gene_model
Chromosome:	Gm08
Start:	37483757
stop:	37484919
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g38430

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G37980	AT	Annotation by Michelle Graham. TAIR10: elicitor-activated gene 3-1 \| chr4:17852670-17854302 FORWARD LENGTH=357	SoyBase	E_val: 4.00E-84	ISS
GO:0009617	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to bacterium	SoyBase	N/A	ISS
GO:0009626	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0009809	GO-bp	Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0016747	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups	SoyBase	N/A	ISS
GO:0045551	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cinnamyl-alcohol dehydrogenase activity	SoyBase	N/A	ISS
PTHR11695	Panther	ALCOHOL DEHYDROGENASE RELATED	JGI		ISS
PTHR11695:SF285	Panther	QUINONE OXIDOREDUCTASE-RELATED	JGI		ISS
PF00107	PFAM	Zinc-binding dehydrogenase	JGI		ISS
UniRef100_G7KGJ2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cinnamyl alcohol dehydrogenase n=1 Tax=Medicago truncatula RepID=G7KGJ2_MEDTR	SoyBase	E_val: 8.00E-110	ISS
UniRef100_UPI000233EBEE	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233EBEE related cluster n=1 Tax=unknown RepID=UPI000233EBEE	SoyBase	E_val: 2.00E-133	ISS

Expression Patterns of Glyma08g38430

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g38430 not represented in the dataset	Glyma08g38430 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g38430 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g280500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g38430

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g38430

Limit To All Plant Sequences

>Glyma08g38430.2   sequence type=CDS   gene model=Glyma08g38430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AACTGTGATGACAATCTTGAGAATTATTGTCCTCAATATACGCTCACATATGGTGCCAAATATAGAGATGGCACCATCACATACGGAGGCTACTCTAACTCAATGGTTGCAGATGAGCATTTTGTGATTCGCATTCCTGATAGCTTAGCACTTGATGCTGCTGCACCTCTTCTTTGTGCTGGCATCACTGTGTATAGCCCTCTCAGATATTATGGACTTGACAAGCCTGACCTACATGTTGGTGTGGTTGGTCTCGGTGGACTAGGCCACATGGCAGTCAAGTTTGCCAAAGCTTTTGGAGCTAAGGTTGCTAGACAACATCTTGGAGTTGATTCCTTTCTACTAAGCCGTGACCAACATCAGATGCAGGCTGCAATGGGTGCTTTGGATGGTATTATTGACACAGTTTCTGCGGTTCATCCTCTCTTACCTCTCATTGGTTTGCTCAAGTCTCATGGAAAGATTGTAATGGTGGGTGCACCAGAGAAGCCTTTGGAACTGCCAGTCTTTCCTTTACTTGATGGGAGAAAGATAGTAGCTGGCAGTCTGATTGGAGGGTTAAAGGAGACACAAGAAATGATTGATTTTGCAGCGAAACACAATGTCAAACCTGACATTGAAGTCATTCTTATGGACTGCCAACACAGCAATGGAACGACTCCTTAA

Predicted protein sequences of Glyma08g38430

Limit To All Plant Sequences

>Glyma08g38430.2   sequence type=predicted peptide   gene model=Glyma08g38430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NCDDNLENYCPQYTLTYGAKYRDGTITYGGYSNSMVADEHFVIRIPDSLALDAAAPLLCAGITVYSPLRYYGLDKPDLHVGVVGLGGLGHMAVKFAKAFGAKVARQHLGVDSFLLSRDQHQMQAAMGALDGIIDTVSAVHPLLPLIGLLKSHGKIVMVGAPEKPLELPVFPLLDGRKIVAGSLIGGLKETQEMIDFAAKHNVKPDIEVILMDCQHSNGTTP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain