Glyma08g38370 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g38370

Feature Type:	gene_model
Chromosome:	Gm08
Start:	37355022
stop:	37356993
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g38370

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G24570	AT	Annotation by Michelle Graham. TAIR10: dicarboxylate carrier 2 \| chr4:12686546-12687487 FORWARD LENGTH=313	SoyBase	E_val: 1.00E-161	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006839	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitochondrial transport	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009612	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus	SoyBase	N/A	ISS
GO:0009693	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005310	GO-mf	Annotation by Michelle Graham. GO Molecular Function: dicarboxylic acid transmembrane transporter activity	SoyBase	N/A	ISS
KOG0759	KOG	Mitochondrial oxoglutarate/malate carrier proteins	JGI		ISS
PTHR24089	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24089:SF78	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00153	PFAM	Mitochondrial carrier protein	JGI		ISS
UniRef100_B9SXH6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial dicarboxylate carrier protein, putative n=1 Tax=Ricinus communis RepID=B9SXH6_RICCO	SoyBase	E_val: 0	ISS
UniRef100_I1KX90	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KX90_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma08g38370

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g38370 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g280300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g38370

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g38370

Limit To All Plant Sequences

>Glyma08g38370.1   sequence type=CDS   gene model=Glyma08g38370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGTCAAAGGTTTCGTCGAAGGAGGCATTGCTTCTGTGATCGCAGGGTGTTCCACACACCCTCTTGATCTCATCAAGGTAAGAATGCAGCTTCAAGGAGAGACCCAGCAACCCTCGAATCTCCGACCCGCACTCGCCTTCCACCCTAGCTCCGTCCACGCGCCGCCGCAGCCGGCGGCCAAGGAGGGTCCCATTGCCGTCGGAGTTAAGTTAGTCCAACAAGAAGGCGTGGCCGCGCTTTTCTCCGGCGTCTCCGCCACCGTCCTCCGCCAGCTTCTCTACTCCACCACTCGCATGGGACTCTACGAGGTGCTCAAGAAGAAATGGTCCGATCCCAATTCTGCCGGAGGCACCTTGTCGCTATCTCGTAAGATAACGGCAGGGTTAATTTCTGGTGGAATCGGCGCAGTCGTTGGAAATCCCGCCGATGTAGCCATGGTCCGCATGCAGGCCGACGGAAGACTTCCGCCGATCCGACAACGGAATTATAAATCCGTCCTTGACGCCATCGCAAGGATGACAAAAGACGAGGGCATCACTAGCTTATGGCGTGGTTCATCGTTAACAGTGAACCGCGCCATGTTAGTGACGGCCTCGCAGCTCGCTTCTTACGACCAGTTCAAGGAGATGATTTTGGAAAAGGGTGTAATGCGTGATGGTCTTGGGACCCATGTAACGTCGAGTTTCGCAGCGGGGTTTGTGGCGGCGGTTACGTCGAACCCCGTTGACGTGATCAAGACTAGGGTGATGAACATGAAGGTGGAACCTGGGGCGGCGCCGCCGTATTCCGGCGCACTGGATTGCGCCTTGAAGACGGTACGCAAAGAGGGCCCCATGGCTCTTTACAAAGGCTTTATTCCCACGATTTCGAGACAAGGACCCTTCACTGTTGTTTTGTTCGTCACGTTAGAACAGGTTCGAAAGTTGCTTAAGGATTTCTAA

Predicted protein sequences of Glyma08g38370

Limit To All Plant Sequences

>Glyma08g38370.1   sequence type=predicted peptide   gene model=Glyma08g38370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGVKGFVEGGIASVIAGCSTHPLDLIKVRMQLQGETQQPSNLRPALAFHPSSVHAPPQPAAKEGPIAVGVKLVQQEGVAALFSGVSATVLRQLLYSTTRMGLYEVLKKKWSDPNSAGGTLSLSRKITAGLISGGIGAVVGNPADVAMVRMQADGRLPPIRQRNYKSVLDAIARMTKDEGITSLWRGSSLTVNRAMLVTASQLASYDQFKEMILEKGVMRDGLGTHVTSSFAAGFVAAVTSNPVDVIKTRVMNMKVEPGAAPPYSGALDCALKTVRKEGPMALYKGFIPTISRQGPFTVVLFVTLEQVRKLLKDF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain