|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G46560 | AT | Annotation by Michelle Graham. TAIR10: transducin family protein / WD-40 repeat family protein | chr2:19115570-19125856 REVERSE LENGTH=2513 | SoyBase | E_val: 5.00E-41 | ISS |
| GO:0000226 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization | SoyBase | N/A | ISS |
| GO:0000911 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation | SoyBase | N/A | ISS |
| GO:0080008 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| PTHR13950 | Panther | RABCONNECTIN-RELATED | JGI | ISS | |
| PTHR13950:SF8 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF12234 | PFAM | RAVE protein 1 C terminal | JGI | ISS | |
| UniRef100_D7LEK9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Transducin family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LEK9_ARALL | SoyBase | E_val: 2.00E-38 | ISS |
| UniRef100_UPI000233BA7A | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233BA7A related cluster n=1 Tax=unknown RepID=UPI000233BA7A | SoyBase | E_val: 2.00E-41 | ISS |
|
Glyma08g38343 not represented in the dataset |
Glyma08g38343 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.08g280100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g38343.1 sequence type=CDS gene model=Glyma08g38343 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTCTACATGGAGAAATTGGCAAGAGCTCAGTATTTGAAGAACAAAATTACCAAGGATTGTGCTTTGCTATATATTGCACTAAATAAAGTTCAACTTTTTGCTGGCATTTTCAAAATCAGTAAGGATGAGAAGGATAAGCCTCTTGTGGGCTTTCTTTCTCGCAATTTTCAGGATGAGAAAAATAAAGTTGTTGCTTTAAAAAATGCTTGTCTTGGAAAGCATCAGTTGGAATTAGCAATTGGTTTCTTTTTGCTTGGAGGTGATCAACTGGAATCTTGGGGATGA
>Glyma08g38343.1 sequence type=predicted peptide gene model=Glyma08g38343 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVYMEKLARAQYLKNKITKDCALLYIALNKVQLFAGIFKISKDEKDKPLVGFLSRNFQDEKNKVVALKNACLGKHQLELAIGFFLLGGDQLESWG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||