Glyma08g38320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g38320

Feature Type:	gene_model
Chromosome:	Gm08
Start:	37301839
stop:	37303058
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g38320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G01710	AT	Annotation by Michelle Graham. TAIR10: Chaperone DnaJ-domain superfamily protein \| chr2:315836-316771 FORWARD LENGTH=311	SoyBase	E_val: 8.00E-39	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0031072	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding	SoyBase	N/A	ISS
GO:0051082	GO-mf	Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding	SoyBase	N/A	ISS
PF00226	PFAM	DnaJ domain	JGI		ISS
UniRef100_G7JXP6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bHLH131 n=1 Tax=Medicago truncatula RepID=G7JXP6_MEDTR	SoyBase	E_val: 4.00E-39	ISS
UniRef100_I1KX87	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KX87_SOYBN	SoyBase	E_val: 5.00E-161	ISS

Expression Patterns of Glyma08g38320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma08g38320

Paralog	Evidence	Comments
Glyma18g29620	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma08g38320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g279900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g38320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g38320

Limit To All Plant Sequences

>Glyma08g38320.2   sequence type=CDS   gene model=Glyma08g38320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAACACGAAACAGACAACATTAACAACAACAACGGAACCCACGACGGGTCCGAAGATTCCGTCCTCCGCCCCTGTCTATCCCTCCTCAAGTGCCGCAGCTTCGCCGCGTGCCACGTGTCCGCTAACAAAATCTCAAGATCCGACCCGAACGTCTCCCTCCACGTGGACCAAATCCTCGCGGTGGCGGACGTCCTCGCGGCGGCGGAGCGCCGCCGCGTCCCCTCCCACCCGCACGACTGGTACTCCATCCTCCGCCTCCTCCCCGGCGACGGCGACAACCGCGACCTGACACGTCAGCACTTCAAAACCCTCGTGCGGCTCCTCGACCCTAACAAGAACAAGCTCCCCTTCGCCGATGAGGCTCTCATGCGCGTGCGAGAAGCGTGGTTCGTTCTCTCAGACCCAACGCGCAAGGCGCGCTTCGATAAAGAGATCAACGACGCCGCCAAAACAAAAACGACATCGTTTTGGACAATGTGCCCTTACTGTTGGTACCTACACGAGTACGAACGGAAATACGAGGACTGCACGTTGAGGTGTTCGAATTGCAAGAGAACTTTTCACGGCGCGGCGGTGACGTCGCCGCGGCCGGAGGCTGTGGCGGCGGGCAACGAGGAGTATTACTGCTACCACGTGAGCTTGCCGGTGAGGTATCCGGTCGGCGGCGAACGGTGTCGTTTTGGGGATGGGGCGAGGAAGAGGATGAGGGTTAAAACGGTGGCTAATAGAATGAAAAAGAAAGGGTTTGTTGTTGATGCTAATAATGATGAATCTGATTTGGATGGGATGAGGTAG

Predicted protein sequences of Glyma08g38320

Limit To All Plant Sequences

>Glyma08g38320.2   sequence type=predicted peptide   gene model=Glyma08g38320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKHETDNINNNNGTHDGSEDSVLRPCLSLLKCRSFAACHVSANKISRSDPNVSLHVDQILAVADVLAAAERRRVPSHPHDWYSILRLLPGDGDNRDLTRQHFKTLVRLLDPNKNKLPFADEALMRVREAWFVLSDPTRKARFDKEINDAAKTKTTSFWTMCPYCWYLHEYERKYEDCTLRCSNCKRTFHGAAVTSPRPEAVAAGNEEYYCYHVSLPVRYPVGGERCRFGDGARKRMRVKTVANRMKKKGFVVDANNDESDLDGMR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain