SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g38280

Feature Type:gene_model
Chromosome:Gm08
Start:37222847
stop:37227198
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G10480AT Annotation by Michelle Graham. TAIR10: Protein-tyrosine phosphatase-like, PTPLA | chr5:3298047-3300048 REVERSE LENGTH=221 SoyBaseE_val: 2.00E-121ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0042761GO-bp Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid biosynthetic process SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048640GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of developmental growth SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0050732GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of peptidyl-tyrosine phosphorylation SoyBaseN/AISS
GO:0051302GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell division SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009923GO-cc Annotation by Michelle Graham. GO Cellular Compartment: fatty acid elongase complex SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0004725GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine phosphatase activity SoyBaseN/AISS
GO:0080023GO-mf Annotation by Michelle Graham. GO Molecular Function: 3R-hydroxyacyl-CoA dehydratase activity SoyBaseN/AISS
KOG3187 KOG Protein tyrosine phosphatase-like protein PTPLA (contains Pro instead of catalytic Arg) JGI ISS
PTHR11035Panther PTPLA DOMAIN PROTEIN JGI ISS
PTHR11035:SF14Panther TYROSINE PHOSPHATASE-LIKE (OS01G0150800 PROTEIN) JGI ISS
PF04387PFAM Protein tyrosine phosphatase-like protein, PTPLA JGI ISS
UniRef100_C6T3G1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T3G1_SOYBN SoyBaseE_val: 2.00E-157ISS
UniRef100_G5DXR7UniRef Annotation by Michelle Graham. Most informative UniRef hit: 3-hydroxyacyl-CoA dehydratase (Fragment) n=1 Tax=Silene latifolia RepID=G5DXR7_SILLA SoyBaseE_val: 5.00E-122ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma18g29520 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g279700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g38280.1   sequence type=CDS   gene model=Glyma08g38280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGGTTTCTTCTCTCTTCTAAGACGCCTCTATCTCTCCCTTTACAATTGGACCGTTTTGTTTGGATGGTGTCAAGTTCTGTATTTTGTTCTCAAGACATTGAACGAATCGGGTCATCAATATGTTTACAATGCAGCAGAAAAGCCTTTGCTTTATGCTCAAACCGCTGCTGTGTTAGAGATTCTTCATGGCTTGGTAGGATTGGTGAGGTCTCCAGTAACAGCAACATTGCCACAGATAAGTTCAAGGCTTTTCCTGGTTTGGGGCATCTTATGGAGTTTTCCTGAGACTCGGTCCCATGTGCTTGTTACCTCCCTACTAATCAGCTGGTCCATCACAGAGATCATTCGCTATTCTTTCTTTGGCTTTAAAGAGACTTTTGGATTTACTCCATCATGGCTTTTGTGGCTTAGATATAGCAGCTTCTTAGTTTTGTATCCAACAGGCATAAGCAGTGAAGTTGGTCTAATATACATTGCCCTACCATTCATTAAGGCATCTGAGAAGTATTGCATAAGGATGCCAAACAAATTGAACTCATCATTTGATTACTTCTATGCCGCGATTGTTGCAATGGGAATCTATGTTCCAGGTAGTCCTCACTTGTACACGTACATGCTTGCACAGAGGAAGAAAGCTCTCTCCAAATCGAAGAGAGAGTAA

>Glyma08g38280.1   sequence type=predicted peptide   gene model=Glyma08g38280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGFFSLLRRLYLSLYNWTVLFGWCQVLYFVLKTLNESGHQYVYNAAEKPLLYAQTAAVLEILHGLVGLVRSPVTATLPQISSRLFLVWGILWSFPETRSHVLVTSLLISWSITEIIRYSFFGFKETFGFTPSWLLWLRYSSFLVLYPTGISSEVGLIYIALPFIKASEKYCIRMPNKLNSSFDYFYAAIVAMGIYVPGSPHLYTYMLAQRKKALSKSKRE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo