Glyma08g38140 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g38140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g38140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g38140

Feature Type:	gene_model
Chromosome:	Gm08
Start:	37018176
stop:	37018843
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g38140

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G38360	AT	Annotation by Michelle Graham. TAIR10: prenylated RAB acceptor 1.B4 \| chr2:16069840-16070502 REVERSE LENGTH=220	SoyBase	E_val: 3.00E-41	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0005768	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endosome	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005802	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG3142	KOG	Prenylated rab acceptor 1	JGI		ISS
PTHR19317	Panther	PRENYLATED RAB ACCEPTOR 1-RELATED	JGI		ISS
PF03208	PFAM	PRA1 family protein	JGI		ISS
UniRef100_G7JKL2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: PRA1 family protein B4 n=1 Tax=Medicago truncatula RepID=G7JKL2_MEDTR	SoyBase	E_val: 5.00E-52	ISS
UniRef100_I1KX73	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KX73_SOYBN	SoyBase	E_val: 9.00E-80	ISS

Expression Patterns of Glyma08g38140

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g38140 not represented in the dataset	Glyma08g38140 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g38140 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma08g38140

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g38140

Limit To All Plant Sequences

>Glyma08g38140.2   sequence type=CDS   gene model=Glyma08g38140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTTTAAGCAGTACAACAATGGGTTCCGCGCTCACCGTCGTAGTTGTATTGAACAACTTGGCCTTCCGTGCCTTCATCAACAACCTCTCCACCTCCATCCGCCATGACCTCGACCAGCACCACCCCTGGTTGGAGCTCGCGGACCATTGTGCGTTCTCGAAACCCGAGTCCTTCTCCGAAGCCACTTTCCATGTCAGCAAAAACTTCTCCTACTTCTGCGTCAACTACTACGTTGTCGTTTCACTCATCCTTACAGTTTCTCTCCTCACTAATCCTTTCTCTCTCATCCTCCTCGTTGGCCTCCTCGCCTCTTGGACCTTCCTCTACCTCTTTCGTCCCTCGGATCAACCTCTCGTCATTCTCGATCGAACATTCTCTGACTTCGAAACCCTAGCCCTCCTCTCTTTTGTTCCT

Predicted protein sequences of Glyma08g38140

Limit To All Plant Sequences

>Glyma08g38140.2   sequence type=predicted peptide   gene model=Glyma08g38140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTLSSTTMGSALTVVVVLNNLAFRAFINNLSTSIRHDLDQHHPWLELADHCAFSKPESFSEATFHVSKNFSYFCVNYYVVVSLILTVSLLTNPFSLILLVGLLASWTFLYLFRPSDQPLVILDRTFSDFETLALLSFVP

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain