SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g38140

Feature Type:gene_model
Chromosome:Gm08
Start:37018176
stop:37018843
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g38140
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G38360AT Annotation by Michelle Graham. TAIR10: prenylated RAB acceptor 1.B4 | chr2:16069840-16070502 REVERSE LENGTH=220 SoyBaseE_val: 3.00E-41ISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3142 KOG Prenylated rab acceptor 1 JGI ISS
PTHR19317Panther PRENYLATED RAB ACCEPTOR 1-RELATED JGI ISS
PF03208PFAM PRA1 family protein JGI ISS
UniRef100_G7JKL2UniRef Annotation by Michelle Graham. Most informative UniRef hit: PRA1 family protein B4 n=1 Tax=Medicago truncatula RepID=G7JKL2_MEDTR SoyBaseE_val: 5.00E-52ISS
UniRef100_I1KX73UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KX73_SOYBN SoyBaseE_val: 9.00E-80ISS

Expression Patterns of Glyma08g38140
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g38140 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma08g38140
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g38140
>Glyma08g38140.2   sequence type=CDS   gene model=Glyma08g38140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTTTAAGCAGTACAACAATGGGTTCCGCGCTCACCGTCGTAGTTGTATTGAACAACTTGGCCTTCCGTGCCTTCATCAACAACCTCTCCACCTCCATCCGCCATGACCTCGACCAGCACCACCCCTGGTTGGAGCTCGCGGACCATTGTGCGTTCTCGAAACCCGAGTCCTTCTCCGAAGCCACTTTCCATGTCAGCAAAAACTTCTCCTACTTCTGCGTCAACTACTACGTTGTCGTTTCACTCATCCTTACAGTTTCTCTCCTCACTAATCCTTTCTCTCTCATCCTCCTCGTTGGCCTCCTCGCCTCTTGGACCTTCCTCTACCTCTTTCGTCCCTCGGATCAACCTCTCGTCATTCTCGATCGAACATTCTCTGACTTCGAAACCCTAGCCCTCCTCTCTTTTGTTCCT
Predicted protein sequences of Glyma08g38140
>Glyma08g38140.2   sequence type=predicted peptide   gene model=Glyma08g38140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTLSSTTMGSALTVVVVLNNLAFRAFINNLSTSIRHDLDQHHPWLELADHCAFSKPESFSEATFHVSKNFSYFCVNYYVVVSLILTVSLLTNPFSLILLVGLLASWTFLYLFRPSDQPLVILDRTFSDFETLALLSFVP






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo