Glyma08g38101 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g38101): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g38101): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g38101

Feature Type:	gene_model
Chromosome:	Gm08
Start:	36976759
stop:	36977530
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g38101

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G27760	AT	Annotation by Michelle Graham. TAIR10: tRNAisopentenyltransferase 2 \| chr2:11824860-11827432 FORWARD LENGTH=466	SoyBase	E_val: 2.00E-18	ISS
GO:0007131	GO-bp	Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination	SoyBase	N/A	ISS
GO:0008033	GO-bp	Annotation by Michelle Graham. GO Biological Process: tRNA processing	SoyBase	N/A	ISS
GO:0009691	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinin biosynthetic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0009824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: AMP dimethylallyltransferase activity	SoyBase	N/A	ISS
GO:0052381	GO-mf	Annotation by Michelle Graham. GO Molecular Function: tRNA dimethylallyltransferase activity	SoyBase	N/A	ISS
UniRef100_A8W7I2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: tRNA isopentenyltransferase n=1 Tax=Lotus japonicus RepID=A8W7I2_LOTJA	SoyBase	E_val: 3.00E-28	ISS
UniRef100_I1LKV0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LKV0_SOYBN	SoyBase	E_val: 3.00E-32	ISS

Expression Patterns of Glyma08g38101

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g38101 not represented in the dataset	Glyma08g38101 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g38101 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g278400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g38101

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g38101

Limit To All Plant Sequences

>Glyma08g38101.1   sequence type=CDS   gene model=Glyma08g38101   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACATGTCTACACGTGTTTTTTGGGTTTCAGATAAATCAATATATTAATTTGTACAATGGCACTAGTGTTCTTCCTAGCAATATTTTTCAAGGAAAGGCAGCAAAGAAGTGGGGTCAAGTTGATAACTTAAGATATGATTGTTGTTTTATATGTGTGGATGCATTTCTCCCTGTACTGGATAGATATGTAGAGCAGAGGGTAGATTGA

Predicted protein sequences of Glyma08g38101

Limit To All Plant Sequences

>Glyma08g38101.1   sequence type=predicted peptide   gene model=Glyma08g38101   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTCLHVFFGFQINQYINLYNGTSVLPSNIFQGKAAKKWGQVDNLRYDCCFICVDAFLPVLDRYVEQRVD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain