Glyma08g37970 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g37970

Feature Type:	gene_model
Chromosome:	Gm08
Start:	36787799
stop:	36789706
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g37970

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G62950	AT	Annotation by Michelle Graham. TAIR10: RNA polymerase II, Rpb4, core protein \| chr5:25262447-25263033 REVERSE LENGTH=106	SoyBase	E_val: 7.00E-36	ISS
GO:0006351	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0044237	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular metabolic process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0003899	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity	SoyBase	N/A	ISS
KOG4168	KOG	Predicted RNA polymerase III subunit C17	JGI		ISS
PTHR15561	Panther	CALCITONIN GENE-RELATED PEPTIDE-RECEPTOR COMPONENT PROTEIN	JGI		ISS
PF03874	PFAM	RNA polymerase Rpb4	JGI		ISS
UniRef100_A8MS47	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RNA polymerase II, Rpb4, core protein n=1 Tax=Arabidopsis thaliana RepID=A8MS47_ARATH	SoyBase	E_val: 3.00E-33	ISS
UniRef100_I1KX67	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KX67_SOYBN	SoyBase	E_val: 4.00E-57	ISS

Expression Patterns of Glyma08g37970

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g37970 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g277800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g37970

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g37970

Limit To All Plant Sequences

>Glyma08g37970.2   sequence type=CDS   gene model=Glyma08g37970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCCGTCGCCGAGGGCAATGCTGGTGCACTCATAAATTTTGAGGTCCTTGATTTCTTACGAGCTAAAGGAGCTTCACAGGATCCAACAAGAGTTATTGCCAAATTACCGCAGTTTGAATACAAGGTTTATGATTATTTGGTTGACACTGTTGCCTCTGTTCAAACAAGAGAGAGCATCAATGAGTTCTTGACAAGTGTTAAACAGTATGACCTGGCAAAAGCTGAGGCTCTGAACATATTAAACATTGGGCCAGCTGCTTATTTTGAACTATACCCAGTAAGTATCAATATTTTGATTTTCCAATTTATGTTACACCTAAGCATTTAG

Predicted protein sequences of Glyma08g37970

Limit To All Plant Sequences

>Glyma08g37970.2   sequence type=predicted peptide   gene model=Glyma08g37970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPVAEGNAGALINFEVLDFLRAKGASQDPTRVIAKLPQFEYKVYDYLVDTVASVQTRESINEFLTSVKQYDLAKAEALNILNIGPAAYFELYPVSINILIFQFMLHLSI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain