Glyma08g37900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g37900

Feature Type:	gene_model
Chromosome:	Gm08
Start:	36708534
stop:	36709216
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g37900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G28510	AT	Annotation by Michelle Graham. TAIR10: prohibitin 1 \| chr4:14084970-14086372 REVERSE LENGTH=288	SoyBase	E_val: 5.00E-32	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005747	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
PTHR23222	Panther	PROHIBITIN	JGI		ISS
UniRef100_B9RVS2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Prohibitin, putative n=1 Tax=Ricinus communis RepID=B9RVS2_RICCO	SoyBase	E_val: 1.00E-30	ISS
UniRef100_I1LKN6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1LKN6_SOYBN	SoyBase	E_val: 1.00E-40	ISS

Expression Patterns of Glyma08g37900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g37900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma08g37900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g37900

Limit To All Plant Sequences

>Glyma08g37900.1   sequence type=CDS   gene model=Glyma08g37900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGAAAAAAATTGAAAATAGTTTCTTGGGTCACCGAGCCATTGTTTTCAACTGTCTAGTTGGTGTCAAAGACAAGGTCTATCCTGAAGGAACTCACTTCTTAATTCCGTGGTTTAAGAGGCCGGTTATCTATGATATCCGTGCACGACCCCATCTAGTTGAGAGTACATCTGGGAGTCGTGATCTACAGATGTCACAGAGAAATGGTTTTGGACTTTTTGCATTAGTTTCTCTACTTTGTTCCTTAATTTCTTTTTTGATGGTCTGTTTGTGTGGATATTATCTTGTCCTTGTGTTACATACATCATTGTTACTGGGCCAAACTTTAGCTAACTAA

Predicted protein sequences of Glyma08g37900

Limit To All Plant Sequences

>Glyma08g37900.1   sequence type=predicted peptide   gene model=Glyma08g37900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KKKIENSFLGHRAIVFNCLVGVKDKVYPEGTHFLIPWFKRPVIYDIRARPHLVESTSGSRDLQMSQRNGFGLFALVSLLCSLISFLMVCLCGYYLVLVLHTSLLLGQTLAN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain