|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G31350 | AT | Annotation by Michelle Graham. TAIR10: glyoxalase 2-5 | chr2:13368451-13370802 FORWARD LENGTH=323 | SoyBase | E_val: 2.00E-32 | ISS |
| GO:0019243 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0004416 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydroxyacylglutathione hydrolase activity | SoyBase | N/A | ISS |
| GO:0005506 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: iron ion binding | SoyBase | N/A | ISS |
| GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
| GO:0016787 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrolase activity | SoyBase | N/A | ISS |
| PTHR11935 | Panther | BETA LACTAMASE DOMAIN | JGI | ISS | |
| PTHR11935:SF7 | Panther | GLYOXYLASE-RELATED | JGI | ISS | |
| UniRef100_G7IS04 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Hydroxyacylglutathione hydrolase n=1 Tax=Medicago truncatula RepID=G7IS04_MEDTR | SoyBase | E_val: 5.00E-32 | ISS |
| UniRef100_I1MD50 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MD50_SOYBN | SoyBase | E_val: 5.00E-37 | ISS |
|
Glyma08g37890 not represented in the dataset |
Glyma08g37890 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g37890.1 sequence type=CDS gene model=Glyma08g37890 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high AAAAGGATTCCTGCCATTGATATCCACTTGAACCATGGCGATAAGTGGATGTTTGCTGGCCATGAGGTGCGTGTAATGGACACTCCTGGCCATATAAGCTTCTATTTTCCTGGATCTGGGGCAATTTTTACCGGAGACACTTTTTTCAGCTTATCATGTGGCAAGCTCTTTGAAGGAACCCCACAGCAGGTT
>Glyma08g37890.1 sequence type=predicted peptide gene model=Glyma08g37890 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high KRIPAIDIHLNHGDKWMFAGHEVRVMDTPGHISFYFPGSGAIFTGDTFFSLSCGKLFEGTPQQV
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||