Glyma08g37741 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g37741): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g37741): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g37741

Feature Type:	gene_model
Chromosome:	Gm08
Start:	36533878
stop:	36534170
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g37741

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G52140	AT	Annotation by Michelle Graham. TAIR10: tetratricopeptide repeat (TPR)-containing protein \| chr3:19333232-19341295 FORWARD LENGTH=1403	SoyBase	E_val: 9.00E-20	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0010498	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
UniRef100_G5DXD1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Tetratricopeptide repeat (TPR)-containing protein (Fragment) n=1 Tax=Silene latifolia RepID=G5DXD1_SILLA	SoyBase	E_val: 2.00E-20	ISS
UniRef100_UPI000233A1DC	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A1DC related cluster n=1 Tax=unknown RepID=UPI000233A1DC	SoyBase	E_val: 3.00E-31	ISS

Expression Patterns of Glyma08g37741

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g37741 not represented in the dataset	Glyma08g37741 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g37741 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g277300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g37741

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g37741

Limit To All Plant Sequences

>Glyma08g37741.1   sequence type=CDS   gene model=Glyma08g37741   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTTGCCCTTTTTGTAACCAAATCAGACATTATCTTCTTGATTTGTTGAGAGTAACTCCTCGTGATGCCAACTATACTGGACCTGGTTCCCGATTTTGTATCTTGAGACCAGAATTAATTACTGCCTATTGCCAAGCCCAAGCAGCAAAGGCATTGAAATCTAAGGAGAAGAATTTTCAAGAGGTAGACAATTTGGCCACTGAATCCTGA

Predicted protein sequences of Glyma08g37741

Limit To All Plant Sequences

>Glyma08g37741.1   sequence type=predicted peptide   gene model=Glyma08g37741   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLCPFCNQIRHYLLDLLRVTPRDANYTGPGSRFCILRPELITAYCQAQAAKALKSKEKNFQEVDNLATES*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain