|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G00026 | AT | Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: cultured cell; CONTAINS InterPro DOMAIN/s: Mitochondrial inner membrane translocase complex, subunit Tim21 (InterPro:IPR013261); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr4:11634-13285 REVERSE LENGTH=269 | SoyBase | E_val: 4.00E-15 | ISS |
| GO:0090351 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seedling development | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF12327 | PFAM | FtsZ family, C-terminal domain | JGI | ISS | |
| UniRef100_C6TAF0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TAF0_SOYBN | SoyBase | E_val: 6.00E-17 | ISS |
| UniRef100_Q10NZ2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=2 Tax=Oryza sativa Japonica Group RepID=Q10NZ2_ORYSJ | SoyBase | E_val: 1.00E-13 | ISS |
|
Glyma08g37602 not represented in the dataset |
Glyma08g37602 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g37602.1 sequence type=CDS gene model=Glyma08g37602 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAGGATTGGATTTCCAATTACTTGTCATGGTCAGGAGAGTAGAAATCGAGCTGCTTGCCAAAGAATTCCTCACAGGGTATGGACTGATGAGGAAGGTGTTGAGCATGTGGAGGTAAACACGGCAGCAGAGGTCATATATGACCTCGTGGACCCTACTGCTAATTTAATATTTGGTGCAGTAATAGATCCATCACTCAGTGGTCAAGATATTGATGTTTTGAATGGGGATAACATGGGATGA
>Glyma08g37602.1 sequence type=predicted peptide gene model=Glyma08g37602 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MRIGFPITCHGQESRNRAACQRIPHRVWTDEEGVEHVEVNTAAEVIYDLVDPTANLIFGAVIDPSLSGQDIDVLNGDNMG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||