Glyma08g37440 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g37440

Feature Type:	gene_model
Chromosome:	Gm08
Start:	36066124
stop:	36067217
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g37440

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G54850	AT	Annotation by Michelle Graham. TAIR10: plant U-box 14 \| chr3:20321524-20323848 FORWARD LENGTH=632	SoyBase	E_val: 2.00E-45	ISS
GO:0016567	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein ubiquitination	SoyBase	N/A	ISS
GO:0046777	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation	SoyBase	N/A	ISS
GO:0000151	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0005871	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: kinesin complex	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0019894	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinesin binding	SoyBase	N/A	ISS
GO:0070696	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transmembrane receptor protein serine/threonine kinase binding	SoyBase	N/A	ISS
PTHR23315	Panther	BETA CATENIN-RELATED ARMADILLO REPEAT-CONTAINING	JGI		ISS
PTHR23315:SF31	Panther	OS06G0102700 PROTEIN	JGI		ISS
UniRef100_B9SUD5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: E3 ubiquitin ligase PUB14, putative n=1 Tax=Ricinus communis RepID=B9SUD5_RICCO	SoyBase	E_val: 7.00E-80	ISS
UniRef100_UPI0002339704	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339704 related cluster n=1 Tax=unknown RepID=UPI0002339704	SoyBase	E_val: 6.00E-137	ISS

Expression Patterns of Glyma08g37440

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g37440 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g275800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g37440

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g37440

Limit To All Plant Sequences

>Glyma08g37440.1   sequence type=CDS   gene model=Glyma08g37440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTGTGGCTATGTGTGTGTATAGGTGTGTGTGTGTGTGTGTTTGTGTGTGTGTGTGTGTAACTTGCCCCAAGACACAGCAGACACTTGTGCATACAGCCCTTACCCCTAACTATGTTTTGAAGAGTTTGATTGCTTTGTGGTGTGAAAGCAACGGTATTGAGCTACCAAAGAGGCAAGGAAACTGTAGAACAAAGAAATGTGGTGGCAGCAGTCTTTCAGATTGTGATCGAACTGCTATTGGTGCTTTATTGGATAAACTAACGAGTAACGATATAGAACAACAAAGGGCAGCTGCTGGTAAGAAGGATGCTGCTACTGCTCTAATAAAGTTACTTTGTGAAGGTACTCCTACAGCAAGAGTTGTAAAAGCTGGTATAGTAGCCCCACTGATACAATTTTTGAAGGATGCTGGGGGTGGAATGGTAGATGAAGCACTAGCTATTATGGCAATCCTTGCAAGCCACCATGAAGGCAGGGTAGCGATCGGTCAGGCCAAGCCAATTCATATTCTTGTTGAGGTTATACGAACCGGCTCTCCACGCAATCGAGAGAATGTTGTTGCTGTCTTGTGGTCACTATGCACCGGAGATCCACTGCAATTAAAACTAGCGAAAGAACATGGAACAGAAGCAGCACTGCAGGAGTTGTCAGAAAATGGAACTGATAGAGCTAAGAGAAAAGGTAGCAATGCAGGGTTATTGTATTCTATTTAG

Predicted protein sequences of Glyma08g37440

Limit To All Plant Sequences

>Glyma08g37440.1   sequence type=predicted peptide   gene model=Glyma08g37440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCVAMCVYRCVCVCVCVCVCVTCPKTQQTLVHTALTPNYVLKSLIALWCESNGIELPKRQGNCRTKKCGGSSLSDCDRTAIGALLDKLTSNDIEQQRAAAGKKDAATALIKLLCEGTPTARVVKAGIVAPLIQFLKDAGGGMVDEALAIMAILASHHEGRVAIGQAKPIHILVEVIRTGSPRNRENVVAVLWSLCTGDPLQLKLAKEHGTEAALQELSENGTDRAKRKGSNAGLLYSI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain