SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g37350): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g37350): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g37350

Feature Type:gene_model
Chromosome:Gm08
Start:35805951
stop:35807354
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G45770AT Annotation by Michelle Graham. TAIR10: Polyketide synthase, enoylreductase family protein | chr3:16805753-16807460 REVERSE LENGTH=297 SoyBaseE_val: 2.00E-62ISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016747GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups SoyBaseN/AISS
PTHR11695Panther ALCOHOL DEHYDROGENASE RELATED JGI ISS
PTHR11695:SF15Panther gb def: adh [geobacillus thermoleovorans] JGI ISS
PF00107PFAM Zinc-binding dehydrogenase JGI ISS
UniRef100_G7IU75UniRef Annotation by Michelle Graham. Most informative UniRef hit: Trans-2-enoyl CoA reductase n=1 Tax=Medicago truncatula RepID=G7IU75_MEDTR SoyBaseE_val: 9.00E-65ISS
UniRef100_UPI000233823CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233823C related cluster n=1 Tax=unknown RepID=UPI000233823C SoyBaseE_val: 7.00E-82ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g37350 not represented in the dataset

Glyma08g37350 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g37350.1   sequence type=CDS   gene model=Glyma08g37350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCTACACTTCGCGTCTTCCATTTTGCACGTGTTACGCCTCACCGAGCCATTCCCTTCCCTCCACAACACTCACTGGATGTCAACAGGAGATGTTATTGTGCAAAATGGGGCGACCAACATGGTTGGCCAGTGTGTCATTCAGATTGCAAAATCGTGTGGCATTCCCAATATTAATATTATAAGGGACATGTCTGGGGTCGACGAAGTAAAAGAAAGGCTTAAGAATTTGGGTGCTGATGAAGTTTTCACTGAGAGCGAATTGGAAGTGAAGAATGTCAAGAGTCTCCTGGGTGGTACACCTGAACCTGTTTTGGGATTTAACTGTGTTGGTGGCAATGCTGCTTCTTTGGTACTCAAATTTTTTAGACAGGGAGGAACTATGGCGACTTATGGTGGAATGTCTAAAAAACCTGTCACTGTGTCAACATCAACCTTCATATTTAAGGGCACTGCACTTGTCAGAACTTGGAAGTGGTTCAATGTAGGTGGTTTCAACTTTCAAGTTAAGAAGTTGTTGAGAATGTTTTGGGGTCGG

>Glyma08g37350.1   sequence type=predicted peptide   gene model=Glyma08g37350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALHFASSILHVLRLTEPFPSLHNTHWMSTGDVIVQNGATNMVGQCVIQIAKSCGIPNINIIRDMSGVDEVKERLKNLGADEVFTESELEVKNVKSLLGGTPEPVLGFNCVGGNAASLVLKFFRQGGTMATYGGMSKKPVTVSTSTFIFKGTALVRTWKWFNVGGFNFQVKKLLRMFWGR







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo