Glyma08g37350 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g37350

Feature Type:	gene_model
Chromosome:	Gm08
Start:	35805951
stop:	35807354
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g37350

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G45770	AT	Annotation by Michelle Graham. TAIR10: Polyketide synthase, enoylreductase family protein \| chr3:16805753-16807460 REVERSE LENGTH=297	SoyBase	E_val: 2.00E-62	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0016747	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups	SoyBase	N/A	ISS
PTHR11695	Panther	ALCOHOL DEHYDROGENASE RELATED	JGI		ISS
PTHR11695:SF15	Panther	gb def: adh [geobacillus thermoleovorans]	JGI		ISS
PF00107	PFAM	Zinc-binding dehydrogenase	JGI		ISS
UniRef100_G7IU75	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Trans-2-enoyl CoA reductase n=1 Tax=Medicago truncatula RepID=G7IU75_MEDTR	SoyBase	E_val: 9.00E-65	ISS
UniRef100_UPI000233823C	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233823C related cluster n=1 Tax=unknown RepID=UPI000233823C	SoyBase	E_val: 7.00E-82	ISS

Expression Patterns of Glyma08g37350

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g37350 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma08g37350

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g37350

Limit To All Plant Sequences

>Glyma08g37350.1   sequence type=CDS   gene model=Glyma08g37350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCTACACTTCGCGTCTTCCATTTTGCACGTGTTACGCCTCACCGAGCCATTCCCTTCCCTCCACAACACTCACTGGATGTCAACAGGAGATGTTATTGTGCAAAATGGGGCGACCAACATGGTTGGCCAGTGTGTCATTCAGATTGCAAAATCGTGTGGCATTCCCAATATTAATATTATAAGGGACATGTCTGGGGTCGACGAAGTAAAAGAAAGGCTTAAGAATTTGGGTGCTGATGAAGTTTTCACTGAGAGCGAATTGGAAGTGAAGAATGTCAAGAGTCTCCTGGGTGGTACACCTGAACCTGTTTTGGGATTTAACTGTGTTGGTGGCAATGCTGCTTCTTTGGTACTCAAATTTTTTAGACAGGGAGGAACTATGGCGACTTATGGTGGAATGTCTAAAAAACCTGTCACTGTGTCAACATCAACCTTCATATTTAAGGGCACTGCACTTGTCAGAACTTGGAAGTGGTTCAATGTAGGTGGTTTCAACTTTCAAGTTAAGAAGTTGTTGAGAATGTTTTGGGGTCGG

Predicted protein sequences of Glyma08g37350

Limit To All Plant Sequences

>Glyma08g37350.1   sequence type=predicted peptide   gene model=Glyma08g37350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALHFASSILHVLRLTEPFPSLHNTHWMSTGDVIVQNGATNMVGQCVIQIAKSCGIPNINIIRDMSGVDEVKERLKNLGADEVFTESELEVKNVKSLLGGTPEPVLGFNCVGGNAASLVLKFFRQGGTMATYGGMSKKPVTVSTSTFIFKGTALVRTWKWFNVGGFNFQVKKLLRMFWGR

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain