SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma08g37350

Feature Type:gene_model
Chromosome:Gm08
Start:35805951
stop:35807354
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G45770AT Annotation by Michelle Graham. TAIR10: Polyketide synthase, enoylreductase family protein | chr3:16805753-16807460 REVERSE LENGTH=297 SoyBaseE_val: 2.00E-62ISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016747GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups SoyBaseN/AISS
PTHR11695Panther ALCOHOL DEHYDROGENASE RELATED JGI ISS
PTHR11695:SF15Panther gb def: adh [geobacillus thermoleovorans] JGI ISS
PF00107PFAM Zinc-binding dehydrogenase JGI ISS
UniRef100_G7IU75UniRef Annotation by Michelle Graham. Most informative UniRef hit: Trans-2-enoyl CoA reductase n=1 Tax=Medicago truncatula RepID=G7IU75_MEDTR SoyBaseE_val: 9.00E-65ISS
UniRef100_UPI000233823CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233823C related cluster n=1 Tax=unknown RepID=UPI000233823C SoyBaseE_val: 7.00E-82ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma08g37350.1   sequence type=CDS   gene model=Glyma08g37350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCTACACTTCGCGTCTTCCATTTTGCACGTGTTACGCCTCACCGAGCCATTCCCTTCCCTCCACAACACTCACTGGATGTCAACAGGAGATGTTATTGTGCAAAATGGGGCGACCAACATGGTTGGCCAGTGTGTCATTCAGATTGCAAAATCGTGTGGCATTCCCAATATTAATATTATAAGGGACATGTCTGGGGTCGACGAAGTAAAAGAAAGGCTTAAGAATTTGGGTGCTGATGAAGTTTTCACTGAGAGCGAATTGGAAGTGAAGAATGTCAAGAGTCTCCTGGGTGGTACACCTGAACCTGTTTTGGGATTTAACTGTGTTGGTGGCAATGCTGCTTCTTTGGTACTCAAATTTTTTAGACAGGGAGGAACTATGGCGACTTATGGTGGAATGTCTAAAAAACCTGTCACTGTGTCAACATCAACCTTCATATTTAAGGGCACTGCACTTGTCAGAACTTGGAAGTGGTTCAATGTAGGTGGTTTCAACTTTCAAGTTAAGAAGTTGTTGAGAATGTTTTGGGGTCGG

>Glyma08g37350.1   sequence type=predicted peptide   gene model=Glyma08g37350   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALHFASSILHVLRLTEPFPSLHNTHWMSTGDVIVQNGATNMVGQCVIQIAKSCGIPNINIIRDMSGVDEVKERLKNLGADEVFTESELEVKNVKSLLGGTPEPVLGFNCVGGNAASLVLKFFRQGGTMATYGGMSKKPVTVSTSTFIFKGTALVRTWKWFNVGGFNFQVKKLLRMFWGR







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo