SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g37195

Feature Type:gene_model
Chromosome:Gm08
Start:35544120
stop:35544776
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g37195
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G57110AT Annotation by Michelle Graham. TAIR10: autoinhibited Ca2+ -ATPase, isoform 8 | chr5:23109729-23116857 REVERSE LENGTH=1074 SoyBaseE_val: 2.00E-25ISS
GO:0006754GO-bp Annotation by Michelle Graham. GO Biological Process: ATP biosynthetic process SoyBaseN/AISS
GO:0006812GO-bp Annotation by Michelle Graham. GO Biological Process: cation transport SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006882GO-bp Annotation by Michelle Graham. GO Biological Process: cellular zinc ion homeostasis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009624GO-bp Annotation by Michelle Graham. GO Biological Process: response to nematode SoyBaseN/AISS
GO:0070588GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005388GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium-transporting ATPase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0015662GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism SoyBaseN/AISS
GO:0043621GO-mf Annotation by Michelle Graham. GO Molecular Function: protein self-association SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PTHR24093Panther FAMILY NOT NAMED JGI ISS
PTHR24093:SF73Panther SUBFAMILY NOT NAMED JGI ISS
PF00122PFAM E1-E2 ATPase JGI ISS
UniRef100_B9RWZ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cation-transporting atpase plant, putative n=1 Tax=Ricinus communis RepID=B9RWZ4_RICCO SoyBaseE_val: 4.00E-31ISS
UniRef100_I1L1F4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1L1F4_SOYBN SoyBaseE_val: 2.00E-36ISS

Expression Patterns of Glyma08g37195
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g37195 not represented in the dataset
Glyma08g37195 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g37195 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g273700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g37195
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g37195
>Glyma08g37195.1   sequence type=CDS   gene model=Glyma08g37195   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAGCATCTCAGAAGATACTAGTGAAGAAACACCATTGCAGGTTCACTTAAATGGTGTAGCTACTTTCATCAGTATTGTAGGACTTACTGTTGTTGTTATTGTCCTAATTGTGCTACTGGCAAGATATTTCTCTGGGCATACTAAAAATCCTGATGGGTCAGTTCAATTCACAACAGGCAAGACTAAAGTTGGTGATGCTATTGATGGTGCAATTAAGATAATAACTGTTGTGGTCACCATCGTAGTGGTTGCAGTACCATAG
Predicted protein sequences of Glyma08g37195
>Glyma08g37195.1   sequence type=predicted peptide   gene model=Glyma08g37195   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASISEDTSEETPLQVHLNGVATFISIVGLTVVVIVLIVLLARYFSGHTKNPDGSVQFTTGKTKVGDAIDGAIKIITVVVTIVVVAVP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo