Report for Sequence Feature Glyma08g36840
Feature Type: gene_model
Chromosome: Gm08
Start: 35183017
stop: 35194460
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma08g36840
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G49640 AT
Annotation by Michelle Graham. TAIR10: Aldolase-type TIM barrel family protein | chr3:18400480-18402809 REVERSE LENGTH=329
SoyBase E_val: 7.00E-178 ISS
GO:0006808 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of nitrogen utilization
SoyBase N/A ISS
GO:0008033 GO-bp
Annotation by Michelle Graham. GO Biological Process: tRNA processing
SoyBase N/A ISS
GO:0055114 GO-bp
Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003824 GO-mf
Annotation by Michelle Graham. GO Molecular Function: catalytic activity
SoyBase N/A ISS
GO:0017150 GO-mf
Annotation by Michelle Graham. GO Molecular Function: tRNA dihydrouridine synthase activity
SoyBase N/A ISS
GO:0050660 GO-mf
Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding
SoyBase N/A ISS
PTHR11082 Panther
TRNA-DIHYDROURIDINE SYNTHASE
JGI ISS
PTHR11082:SF4 Panther
NITROGEN REGULATION PROTEIN NIFR3-RELATED
JGI ISS
PF01207 PFAM
Dihydrouridine synthase (Dus)
JGI ISS
UniRef100_I1KX37 UniRef
Annotation by Michelle Graham. Best UniRef hit: tRNA-dihydrouridine synthase n=2 Tax=Glycine max RepID=I1KX37_SOYBN
SoyBase E_val: 0 ISS
UniRef100_I1KX37 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: tRNA-dihydrouridine synthase n=2 Tax=Glycine max RepID=I1KX37_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma08g36840
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma08g36840
Paralog Evidence Comments
Glyma01g23820 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma08g36840 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.08g273200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma08g36840
Coding sequences of Glyma08g36840
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma08g36840.2 sequence type=CDS gene model=Glyma08g36840 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGTACCGCAACAAACTTGTTCTCGCTCCTATGGTCCGCGTTGGCACTCTCCCATTTAGATTACTAGCTGCTCAATATGGTGCAGATATCACTTACTGCGAGGAAATCATTGACCACAAGATGCTAAAGTGCGAGCGCCGAATTAACGAACTCATTGGATCCACTGATTTTGTGGAGAAGGGGACAAACAATGTTGTGTTTAGAACCTGTGATGAAGAAAAAGATAGGGTTGTGTTTCAAATAGGAACATCAGATGCTGTGAGGGCCCTAACTACTGCTCAGTTAGTGTGTAATGATGTTGCTGCAGTAGATATTAACATGGGTTGCCCGAAGTCATTTTCTGTGAGTGGTGGAATGGGTGCTGCTCTGTTGTCCAAACCAGAGCTTATTCATGATATCTTAACAACATTAAAGAGGAATTTGAACACACCAGTAACATGTAAGATTCGACTTCTAAAATCACCACATGATACCGTGGAATTAGCCAGACGAATTGAGAAAACTGGTGTTTCTGCTCTTGCAGTCCATGGAAGAAAAGTCCCAGATAGGCCCAGAGATCCTGCTAAGTGGAATGAAATCGCTGATGTTGTGTCAGCATTATCTATTCCAGTTATAGAAAATGGTGATGTTTTTGAGAATGATGATGTTGAACGCATTAAATCTGCCACAGGTGCCTCGTCAGTGATGGTTGCCAGAGGGGCACTCTGGAATGCTTCAATGTTTTCGCCCGAGGGCAAAGTTTCTTATGAAGCTGTGAAAAGAGAATATATTAGGAAGTGCATCTTGTGGGATAATGATATAAAAAGCACCAAGCATACATTAAAGGAAATGATAATACATTATTCTTGTCTAGAACTGCCTGAAGGGAAGGCTGTGATCAAATCAGAGTCCATGGCTGATCTAGCGTTGGTCAAAGCAATCTCTATTCAACTCAACCTTATCTTTCCACCACCATCATCTCGTCTAAAGCCCAAATCACTCAACAGTCACAGTCATGTGGTGCATCAAACATTGAATAGTATAAAAGTTTAA
Predicted protein sequences of Glyma08g36840
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma08g36840.2 sequence type=predicted peptide gene model=Glyma08g36840 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEYRNKLVLAPMVRVGTLPFRLLAAQYGADITYCEEIIDHKMLKCERRINELIGSTDFVEKGTNNVVFRTCDEEKDRVVFQIGTSDAVRALTTAQLVCNDVAAVDINMGCPKSFSVSGGMGAALLSKPELIHDILTTLKRNLNTPVTCKIRLLKSPHDTVELARRIEKTGVSALAVHGRKVPDRPRDPAKWNEIADVVSALSIPVIENGDVFENDDVERIKSATGASSVMVARGALWNASMFSPEGKVSYEAVKREYIRKCILWDNDIKSTKHTLKEMIIHYSCLELPEGKAVIKSESMADLALVKAISIQLNLIFPPPSSRLKPKSLNSHSHVVHQTLNSIKV*