|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G53020 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein L24e family protein | chr3:19660749-19661912 REVERSE LENGTH=163 | SoyBase | E_val: 1.00E-47 | ISS |
| GO:0001510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA methylation | SoyBase | N/A | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0009734 | GO-bp | Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0042254 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis | SoyBase | N/A | ISS |
| GO:0048467 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gynoecium development | SoyBase | N/A | ISS |
| GO:0005730 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleolus | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
| GO:0022625 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| PTHR10792 | Panther | 60S RIBOSOMAL PROTEIN L24 | JGI | ISS | |
| PF01246 | PFAM | Ribosomal protein L24e | JGI | ISS | |
| UniRef100_B9SRL5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L24, putative n=1 Tax=Ricinus communis RepID=B9SRL5_RICCO | SoyBase | E_val: 2.00E-47 | ISS |
| UniRef100_UPI00023380CD | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI00023380CD related cluster n=1 Tax=unknown RepID=UPI00023380CD | SoyBase | E_val: 4.00E-52 | ISS |
|
Glyma08g36800 not represented in the dataset |
Glyma08g36800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.08g272900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g36800.1 sequence type=CDS gene model=Glyma08g36800 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GTTTTCCTGTTTGCAAACTCAAAATGTAAGAGGTATTTCCATAATCGCCTGAAGCCTTCAAAGCTCACCTGGACTGTAGTGTACAGAAAGCAACACAAAAAGGACATTGCTCAAGAAGTTGTGAAGAAGAGGAGACGTGCTGCCAAAAAGCCTTACTCTAGGTCCATTGTTGGTGCAACCTTGGAAGTAATCCAAAAAAAAAGAGTTGAGAAGCCAGAAGTTCGAGATGCAGTTAGGGAAGCTGCTCTTCGG
>Glyma08g36800.1 sequence type=predicted peptide gene model=Glyma08g36800 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high VFLFANSKCKRYFHNRLKPSKLTWTVVYRKQHKKDIAQEVVKKRRRAAKKPYSRSIVGATLEVIQKKRVEKPEVRDAVREAALR
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||