SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g36800

Feature Type:gene_model
Chromosome:Gm08
Start:35127670
stop:35128088
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g36800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G53020AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L24e family protein | chr3:19660749-19661912 REVERSE LENGTH=163 SoyBaseE_val: 1.00E-47ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009734GO-bp Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0048467GO-bp Annotation by Michelle Graham. GO Biological Process: gynoecium development SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR10792Panther 60S RIBOSOMAL PROTEIN L24 JGI ISS
PF01246PFAM Ribosomal protein L24e JGI ISS
UniRef100_B9SRL5UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L24, putative n=1 Tax=Ricinus communis RepID=B9SRL5_RICCO SoyBaseE_val: 2.00E-47ISS
UniRef100_UPI00023380CDUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023380CD related cluster n=1 Tax=unknown RepID=UPI00023380CD SoyBaseE_val: 4.00E-52ISS

Expression Patterns of Glyma08g36800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g36800 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g272900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g36800
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g36800
>Glyma08g36800.1   sequence type=CDS   gene model=Glyma08g36800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTTTCCTGTTTGCAAACTCAAAATGTAAGAGGTATTTCCATAATCGCCTGAAGCCTTCAAAGCTCACCTGGACTGTAGTGTACAGAAAGCAACACAAAAAGGACATTGCTCAAGAAGTTGTGAAGAAGAGGAGACGTGCTGCCAAAAAGCCTTACTCTAGGTCCATTGTTGGTGCAACCTTGGAAGTAATCCAAAAAAAAAGAGTTGAGAAGCCAGAAGTTCGAGATGCAGTTAGGGAAGCTGCTCTTCGG
Predicted protein sequences of Glyma08g36800
>Glyma08g36800.1   sequence type=predicted peptide   gene model=Glyma08g36800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VFLFANSKCKRYFHNRLKPSKLTWTVVYRKQHKKDIAQEVVKKRRRAAKKPYSRSIVGATLEVIQKKRVEKPEVRDAVREAALR






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo