SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g36711

Feature Type:gene_model
Chromosome:Gm08
Start:34943227
stop:34946870
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g36711
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G60930AT Annotation by Michelle Graham. TAIR10: RECQ helicase L4B | chr1:22431093-22438302 REVERSE LENGTH=1150 SoyBaseE_val: 1.00E-16ISS
GO:0006260GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication SoyBaseN/AISS
GO:0006281GO-bp Annotation by Michelle Graham. GO Biological Process: DNA repair SoyBaseN/AISS
GO:0006310GO-bp Annotation by Michelle Graham. GO Biological Process: DNA recombination SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0044237GO-bp Annotation by Michelle Graham. GO Biological Process: cellular metabolic process SoyBaseN/AISS
GO:0070417GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to cold SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003678GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA helicase activity SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004386GO-mf Annotation by Michelle Graham. GO Molecular Function: helicase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008026GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity SoyBaseN/AISS
GO:0043140GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent 3'-5' DNA helicase activity SoyBaseN/AISS
PTHR13710Panther DNA HELICASE RECQ FAMILY MEMBER JGI ISS
PTHR13710:SF13Panther RECQ HELICASE 5 JGI ISS
UniRef100_G7INR2UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP-dependent DNA helicase Q1 n=1 Tax=Medicago truncatula RepID=G7INR2_MEDTR SoyBaseE_val: 9.00E-23ISS
UniRef100_I1KUN5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KUN5_SOYBN SoyBaseE_val: 1.00E-25ISS

Expression Patterns of Glyma08g36711
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g36711 not represented in the dataset
Glyma08g36711 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g36711 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g271800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g36711
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g36711
>Glyma08g36711.1   sequence type=CDS   gene model=Glyma08g36711   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTTGGCTTTCCACCTCACAGTATCTTTTTGCTATTTTTTTATTTTTATTTTTGCGATTTTTTTTGGATCAAGGTGTCTGTGGCTCAGTGGTATTTTGGGTTCAATCGCTTACAATTGCTCTCGATGGTTCTGTTGGGTTCACTTCAACCATGGTAGTTATTGTGAAAAAGATGTTGATTGTCGGCGCCTTCTGCAGCTTGCTCATTTTGGGGAGAAGTTCAATTCTTCAACTTGTCAGAAAACATGTGATAATTGCTTGAAGATCACAAGTTTCATTGAAAATGATGTCAGAGAGATTGCAAAGCAATTGGTTTGGGAGAAATTTCTATCCATATATTTTTTTCATCCCTCCACTTATTTAATTTCTTTTTAG
Predicted protein sequences of Glyma08g36711
>Glyma08g36711.1   sequence type=predicted peptide   gene model=Glyma08g36711   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLAFHLTVSFCYFFIFIFAIFFGSRCLWLSGILGSIAYNCSRWFCWVHFNHGSYCEKDVDCRRLLQLAHFGEKFNSSTCQKTCDNCLKITSFIENDVREIAKQLVWEKFLSIYFFHPSTYLISF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo