Glyma08g36416 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g36416): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g36416): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g36416

Feature Type:	gene_model
Chromosome:	Gm08
Start:	34263064
stop:	34263709
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g36416

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G29410	AT	Annotation by Michelle Graham. TAIR10: Ribosomal L28e protein family \| chr4:14468439-14469964 REVERSE LENGTH=143	SoyBase	E_val: 2.00E-22	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0009220	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0034968	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone lysine methylation	SoyBase	N/A	ISS
GO:0042254	GO-bp	Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
PTHR10544	Panther	60S RIBOSOMAL PROTEIN L28	JGI		ISS
PF01778	PFAM	Ribosomal L28e protein family	JGI		ISS
UniRef100_C6T0W1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T0W1_SOYBN	SoyBase	E_val: 6.00E-31	ISS
UniRef100_G7IUL4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L28-1 n=1 Tax=Medicago truncatula RepID=G7IUL4_MEDTR	SoyBase	E_val: 3.00E-25	ISS

Expression Patterns of Glyma08g36416

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g36416 not represented in the dataset	Glyma08g36416 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g36416 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g270100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g36416

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g36416

Limit To All Plant Sequences

>Glyma08g36416.1   sequence type=CDS   gene model=Glyma08g36416   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGATCATACTCAGAGCATGCAAAAAATTGATGAGCATCCTAAAGAAGAACAACTCTTTCTTGGTGAAAGAGTTCGGAAGGGGCACTCAGAGTGTGCAGTTCAGCAAAGAGCCCAAAAATCTCTATAACCTCAACACTTTCAAGTACTCCGGTTTGGCGAACAAGAAAACTGTCACTGTTCAACCTACGGGTAAAGACCAGTCTGTGTAG

Predicted protein sequences of Glyma08g36416

Limit To All Plant Sequences

>Glyma08g36416.1   sequence type=predicted peptide   gene model=Glyma08g36416   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIILRACKKLMSILKKNNSFLVKEFGRGTQSVQFSKEPKNLYNLNTFKYSGLANKKTVTVQPTGKDQSV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain