|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT4G12590 | AT | Annotation by Michelle Graham. TAIR10: Protein of unknown function DUF106, transmembrane | chr4:7451291-7452976 REVERSE LENGTH=246 | SoyBase | E_val: 1.00E-24 | ISS |
GO:0000902 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell morphogenesis | SoyBase | N/A | ISS |
GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
GO:0016049 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell growth | SoyBase | N/A | ISS |
GO:0048193 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport | SoyBase | N/A | ISS |
GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
PTHR13116 | Panther | UNCHARACTERIZED | JGI | ISS | |
PF01956 | PFAM | Integral membrane protein DUF106 | JGI | ISS | |
UniRef100_B9S3I8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein pob, putative n=1 Tax=Ricinus communis RepID=B9S3I8_RICCO | SoyBase | E_val: 3.00E-23 | ISS |
UniRef100_C6TID8 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TID8_SOYBN | SoyBase | E_val: 3.00E-26 | ISS |
Glyma08g35490 not represented in the dataset |
Glyma08g35490 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.08g266600 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g35490.1 sequence type=CDS gene model=Glyma08g35490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCAGAAGATCTGGTGCTGGATACAGCAATCAGAGACTGGGGGCTGATCCCTCTCTCTGTGGTTATGGTTCTCATTGGGGTGCTCCGTTATTTTGTTTCTAAGCTTATGCACTCTTCTCAAACCCCTGATGCCAAAATTGTTAAAGAAGGAAACATCGGGCTTCTCAAGGAAATCTGA
>Glyma08g35490.1 sequence type=predicted peptide gene model=Glyma08g35490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAEDLVLDTAIRDWGLIPLSVVMVLIGVLRYFVSKLMHSSQTPDAKIVKEGNIGLLKEI*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||