SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g35470

Feature Type:gene_model
Chromosome:Gm08
Start:32673673
stop:32677465
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g35470
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G11680AT Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cytosol, plasma membrane; EXPRESSED IN: 26 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: WW-domain-binding protein (InterPro:IPR018826); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:3759463-3760634 FORWARD LENGTH=207 SoyBaseE_val: 5.00E-113ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3294 KOG WW domain binding protein WBP-2, contains GRAM domain JGI ISS
UniRef100_C6T2E5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2E5_SOYBN SoyBaseE_val: 6.00E-151ISS
UniRef100_E5KC15UniRef Annotation by Michelle Graham. Most informative UniRef hit: Classical AGP n=1 Tax=Gunnera manicata RepID=E5KC15_9MAGN SoyBaseE_val: 1.00E-109ISS

Expression Patterns of Glyma08g35470
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g35470 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g266400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g35470
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g35470
>Glyma08g35470.1   sequence type=CDS   gene model=Glyma08g35470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGTTGAATCCTCAACTGTTTCCAAATGGAATGCCCGTTCCTTTCGTGAACGAGATGTTTGTGTTGGCCAGAGACGGCGTCGAATTCGAGGTCGATAAGATTCCTGCCTCTGGCAATCATGGGGGTAATCTCAAAACAAAGGGAATCGTGTATTTGTCGAATATTCGGATGGTCTTCGTTGCTAAAAGTCCAGTTGGACACTTCACTGCTTTTGATATGCCTTTGCTTTACATCCATGGTGAAAAGTTTAACCAGCCAATATTTCACTGCAACAATCTCTCTGGACATGTTGAACCTGTGGTCCCAAATGACCAACACAGAGCTCTTTACTCAACACACTCATTTAAGATCTTATTCAAAGAGGGAGGCTGTGGAACCTTCATTCCCCTTTTCTTCAATTTGATTACTTCAGTGAGGCAGTATAATCAACACACTAATATGCAGACACAAAATTATGTGGATCCTTTGCAGGCATCTCAGACTCCAGTTGATGAGATGATGAGACATGCGTATGTTGATCCTAATGATCCAACAAAAATATTTCTGCAACAACCCAATTCTGATTCTCAGCTTAGGCGTCGAACATATCAGCCACAGGCAGATGGAGGCCATGTCTGA
Predicted protein sequences of Glyma08g35470
>Glyma08g35470.1   sequence type=predicted peptide   gene model=Glyma08g35470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALNPQLFPNGMPVPFVNEMFVLARDGVEFEVDKIPASGNHGGNLKTKGIVYLSNIRMVFVAKSPVGHFTAFDMPLLYIHGEKFNQPIFHCNNLSGHVEPVVPNDQHRALYSTHSFKILFKEGGCGTFIPLFFNLITSVRQYNQHTNMQTQNYVDPLQASQTPVDEMMRHAYVDPNDPTKIFLQQPNSDSQLRRRTYQPQADGGHV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo