SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g35016

Feature Type:gene_model
Chromosome:Gm08
Start:32446661
stop:32448162
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g35016
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G16790AT Annotation by Michelle Graham. TAIR10: hydroxyproline-rich glycoprotein family protein | chr4:9451747-9453168 REVERSE LENGTH=473 SoyBaseE_val: 7.00E-10ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
PF05553PFAM Cotton fibre expressed protein JGI ISS
UniRef100_G7JHP7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glycoprotein-like protein n=1 Tax=Medicago truncatula RepID=G7JHP7_MEDTR SoyBaseE_val: 2.00E-13ISS
UniRef100_I1K0T3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K0T3_SOYBN SoyBaseE_val: 2.00E-130ISS

Expression Patterns of Glyma08g35016
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g35016 not represented in the dataset
Glyma08g35016 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g35016 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma08g35016
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g35016
>Glyma08g35016.1   sequence type=CDS   gene model=Glyma08g35016   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACTAATGCAAACTGTCCGCAAGAGTCATTGCATTCAGTCTCAAACGGGAATCTAAGGTTTGACACTGCACAAACTCTTGTGTCAAGGTTCTTTCAGAGCCCTGTCGAGTCTGATGAAACAAAAGTCCAAACTTGGAGCAGCCAACACTACAGGAACGAACCTGTGGTTGTTGTTGCTGCTCCACGGTTGCAAAAGTATTCTAGTTTTGATGACCAGAGTGGGGAGAAGCCTCTGCTTTTGCCCATTCAAAGCTTCAAATCTCGCTTATCTAAAGAAGTTATTGATGTTCAATCTCAGAACATGTCAACAACCTTCAAAAGAAAAGCTGAAGTTATAATGTTGTCTTCAAACACTTATGTTATAATGTTGTCTTCAAACGCAGAGGATTCGGTGAGGAAGAAGGGCTTCTACAAATCTTGTCCTCCACCACCTCTGCCACCGCCACCAACAATGTTTCAGAAATCAGTGTTCATGAAGCCAAGGTTCGATGGTTCATCCAACGAAGCACCTTCCTTCAATAAGGAGTTGAAGAGAAGCTTCACAAGTGAGAGAACCACACTAGTGGGAAAGAAAACTGATGAAGAAAATAAATCCATGCAAGGCACATTCGTGCCTCTTATGTCACAGCCAGCTGAGAAAGAAAGCCTTCTTGTGGAATCTGACGATGATGATGACGATGATGATACAGAAACCGAGGACCAAGACGTTGAAGGAGGAAGAACCGTTGCTCAGAACAATGACAGGGGAAAGGGTCCACCTGTTATTGGTGGAGAAAATGTGGATAAGAAGGTTGATGAGTTCATTGCTAAGTTTAGAGAGCAAATAAGGCTTCAGAGAATTGAGTCAATCAAGAGGAGTACAAGGAGTGCAAGAAACTCTTCAAGCTAA
Predicted protein sequences of Glyma08g35016
>Glyma08g35016.1   sequence type=predicted peptide   gene model=Glyma08g35016   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTNANCPQESLHSVSNGNLRFDTAQTLVSRFFQSPVESDETKVQTWSSQHYRNEPVVVVAAPRLQKYSSFDDQSGEKPLLLPIQSFKSRLSKEVIDVQSQNMSTTFKRKAEVIMLSSNTYVIMLSSNAEDSVRKKGFYKSCPPPPLPPPPTMFQKSVFMKPRFDGSSNEAPSFNKELKRSFTSERTTLVGKKTDEENKSMQGTFVPLMSQPAEKESLLVESDDDDDDDDTETEDQDVEGGRTVAQNNDRGKGPPVIGGENVDKKVDEFIAKFREQIRLQRIESIKRSTRSARNSSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo