|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G32080 | AT | Annotation by Michelle Graham. TAIR10: membrane protein, putative | chr1:11537572-11539756 REVERSE LENGTH=512 | SoyBase | E_val: 1.00E-52 | ISS |
GO:0009658 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chloroplast organization | SoyBase | N/A | ISS |
GO:0010027 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization | SoyBase | N/A | ISS |
GO:0030003 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis | SoyBase | N/A | ISS |
GO:0070838 | GO-bp | Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0009706 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane | SoyBase | N/A | ISS |
GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
PF04172 | PFAM | LrgB-like family | JGI | ISS | |
UniRef100_B6U217 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: LrgB-like family protein n=1 Tax=Zea mays RepID=B6U217_MAIZE | SoyBase | E_val: 1.00E-43 | ISS |
UniRef100_I1KWY4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KWY4_SOYBN | SoyBase | E_val: 4.00E-59 | ISS |
Glyma08g34680 not represented in the dataset |
Glyma08g34680 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma08g34680.1 sequence type=CDS gene model=Glyma08g34680 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CTTGTGAAAAGACACGCAGCTGAGATTTTCACCTCTGTCATCATCTCAACCTTATTCTCACTGTACTCAACAGCCTTTGTTGGACGTCTTGTTCAATTAGAACCATCTTTAACTGTGTCCATTCTACCCAGATGTATCACAGTGGCATTGGCCCTCAGCATTGTATCCTTGTTTGACGGTGCCAATTCATCTCTCACAGCAGCTGTGGTTGTATTAACTGGTCTGGTTGGAGCAAATTTTGTGCAAGCAACACTCGATAAACTCAGTTTTCGAGATCCAATTGCTCGGGGAATAGCAACTGCTTCTAGGTATATTCTGTGA
>Glyma08g34680.1 sequence type=predicted peptide gene model=Glyma08g34680 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high LVKRHAAEIFTSVIISTLFSLYSTAFVGRLVQLEPSLTVSILPRCITVALALSIVSLFDGANSSLTAAVVVLTGLVGANFVQATLDKLSFRDPIARGIATASRYIL*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||