Glyma08g34600 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g34600

Feature Type:	gene_model
Chromosome:	Gm08
Start:	31702098
stop:	31704749
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g34600

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G32080	AT	Annotation by Michelle Graham. TAIR10: membrane protein, putative \| chr1:11537572-11539756 REVERSE LENGTH=512	SoyBase	E_val: 3.00E-98	ISS
GO:0009658	GO-bp	Annotation by Michelle Graham. GO Biological Process: chloroplast organization	SoyBase	N/A	ISS
GO:0010027	GO-bp	Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization	SoyBase	N/A	ISS
GO:0030003	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis	SoyBase	N/A	ISS
GO:0070838	GO-bp	Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009706	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
UniRef100_B6U217	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: LrgB-like family protein n=1 Tax=Zea mays RepID=B6U217_MAIZE	SoyBase	E_val: 2.00E-94	ISS
UniRef100_I1MMF4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MMF4_SOYBN	SoyBase	E_val: 1.00E-128	ISS

Expression Patterns of Glyma08g34600

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g34600 not represented in the dataset	Glyma08g34600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g34600 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma08g34600

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g34600

Limit To All Plant Sequences

>Glyma08g34600.1   sequence type=CDS   gene model=Glyma08g34600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTTTGGGGTAATCCATTTGGCGGTGTCCCTGGGCCTCATTCTGGCGGTGGACAAGTTTCTGAAGCAAGCGTTCGTGGCTGCTGCAATCAAGTTCCCGAGCGCGTTGTTTGGTATGTTTTGCATATTCTCGGTTCTGATTATTCTCGACTCCACCGTGCCCGCCGCCGCCACGGCGTTCGTGAGCTTCTTCGTGCCCGCGTTTATGTTTATACAGAGATGGCTCCCTCTGTTCTATGTTCCTTCTCTGGTGGTCTTGCCCCTTGCCGTCAAAGATATTCCCGCTGCCTCCGGAGCCAAAATTGGCCTCATTTTAGTTGGAGGATGGCTGGCTACATTTTGTGTTGCTGGTTACGCGGCTATCGCAGTTAGAAAAGCTGTGAAAACGGAATTGGTAGAAGCTGAGCCTATGGGAAAGCCTGCTCCATTTTCCTTGAAATCACTGGGTACAAGTGCCAGAACATGCCTTCCATTTTTGCTTGCAGCTTCAGTGTTAGGCTACATGGTTGGCTCTGGGTTGCCACCAAATGTGAAGAAGGTCTTCCATCCTATAATTTGCTGTGCATTATCTGCAGATCTGACAGCATTTGCTTTTGGGTATTTTTCCAGGTCAGGGCTTGAACCTGTGCTT

Predicted protein sequences of Glyma08g34600

Limit To All Plant Sequences

>Glyma08g34600.1   sequence type=predicted peptide   gene model=Glyma08g34600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVFGVIHLAVSLGLILAVDKFLKQAFVAAAIKFPSALFGMFCIFSVLIILDSTVPAAATAFVSFFVPAFMFIQRWLPLFYVPSLVVLPLAVKDIPAASGAKIGLILVGGWLATFCVAGYAAIAVRKAVKTELVEAEPMGKPAPFSLKSLGTSARTCLPFLLAASVLGYMVGSGLPPNVKKVFHPIICCALSADLTAFAFGYFSRSGLEPVL

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain