SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g34440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g34440): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g34440

Feature Type:gene_model
Chromosome:Gm08
Start:31415533
stop:31417117
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g34440
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11160AT Annotation by Michelle Graham. TAIR10: Transducin/WD40 repeat-like superfamily protein | chr1:3733406-3739363 FORWARD LENGTH=1021 SoyBaseE_val: 1.00E-26ISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
PTHR19845Panther KATANIN P80 SUBUNIT JGI ISS
PF00400PFAM WD domain, G-beta repeat JGI ISS
UniRef100_G7ILH1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Katanin p80 WD40-containing subunit B1 n=1 Tax=Medicago truncatula RepID=G7ILH1_MEDTR SoyBaseE_val: 2.00E-29ISS
UniRef100_UPI000233D62AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D62A related cluster n=1 Tax=unknown RepID=UPI000233D62A SoyBaseE_val: 2.00E-58ISS

Expression Patterns of Glyma08g34440
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g34440 not represented in the dataset
Glyma08g34440 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g34440 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g265800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g34440
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g34440
>Glyma08g34440.1   sequence type=CDS   gene model=Glyma08g34440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGAGTTTGTGTGGTCACACTAGTTCAATAGAAGCAGTGACTTTTGACTCAGCAGAAGTGTTGATTCTTTCTGGAGCATCGTCAGGGGTAATAAAGCTTTCGGATTTGGAAGAAGCAAAGAACTCTAGAGTGCATTTTTGGAGAGAAAAAAGTTCTAAATATTTTACTGAAAATTCCATCTTAGAAAAATTCATTTTTGGTTCAGCAGATAGAACAATGAAATTTTGGGATTTAGAAACCTTTGAACTGATTGGATCTACCAGACATGAGGTTTCGGGGGTACGCTCAATTGCTTTTCATCCTGATGGACAAATCCTATTTGCTGGATTTGAGGATAGTTTGAAGCTTATAGAGCCATATAATGGTAGCTTGGAAACTGAGAAAAAGGAAAGCACAAAACAAAAACTTAGTCTCCAGGGAAGACAAATGGAGAAAGTAGAAGCTGGTGTGGGACCGGCTTTTGGGTTGTGCAGTATGTCTGTTGACAATGAGTCAAAAGAGATAAAGAATGTATATATATAG
Predicted protein sequences of Glyma08g34440
>Glyma08g34440.1   sequence type=predicted peptide   gene model=Glyma08g34440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQSLCGHTSSIEAVTFDSAEVLILSGASSGVIKLSDLEEAKNSRVHFWREKSSKYFTENSILEKFIFGSADRTMKFWDLETFELIGSTRHEVSGVRSIAFHPDGQILFAGFEDSLKLIEPYNGSLETEKKESTKQKLSLQGRQMEKVEAGVGPAFGLCSMSVDNESKEIKNVYI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo