SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g34360

Feature Type:gene_model
Chromosome:Gm08
Start:31406098
stop:31407400
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma08g34360
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G22840AT Annotation by Michelle Graham. TAIR10: growth-regulating factor 1 | chr2:9728841-9731141 FORWARD LENGTH=530 SoyBaseE_val: 4.00E-17ISS
GO:0009624GO-bp Annotation by Michelle Graham. GO Biological Process: response to nematode SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0061062GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of nematode larval development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016818GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides SoyBaseN/AISS
PF08880PFAM QLQ JGI ISS
UniRef100_D9ZIZ8UniRef Annotation by Michelle Graham. Most informative UniRef hit: GRF domain class transcription factor n=1 Tax=Malus x domestica RepID=D9ZIZ8_MALDO SoyBaseE_val: 3.00E-33ISS
UniRef100_UPI000233E4E1UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E4E1 related cluster n=1 Tax=unknown RepID=UPI000233E4E1 SoyBaseE_val: 2.00E-109ISS

Expression Patterns of Glyma08g34360
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g34360 not represented in the dataset
Glyma08g34360 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g34360 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g265700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma08g34360
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma08g34360
>Glyma08g34360.1   sequence type=CDS   gene model=Glyma08g34360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCTTGGGGTGGTGGGTTTGGAGGGGGTGGTGGGTTCAGAAAGTGGTTGTGTGTTTGGTTCTTCTCTTGCTTCAGATCCTGAGACAAAGCACAAGTGGTACGGATCTGGTTTGCTCAAGCAAGAGAGATCTGCCATAGCTAGTGAAGATGATGAGTGGAGAATTTCCAAAGTTGCTAAAACTGATCATGACATGCCTTCAGCCTCCAAAGCAATGCTCTTTCAGCAAAGAAACAACTCTTTGTTGAGATCTAATAATGCAACTCTTTTCTCTGATGGTCATCACCAATCACAAATGTTGAACTTCTCTTCTCCAAAGTCAGAGACTTTATTGGTAGACAAGGCTTTCTCAAATGCCACATTGCCTTTTTCTTATCATCAATTGTCTAGTTACAGCAAAAATACAGGTTACAATTCAGGAAGCATAAGCATGCATGGGGCTTTGGCTAGTGTGAGAGGGCCATTCACTCCATCACAGTGGATGGAGCTTGAACACCAAGCCTTGATCTACAAGTACATCACAGCAAATGTTCTGGACAAGGAATAA
Predicted protein sequences of Glyma08g34360
>Glyma08g34360.1   sequence type=predicted peptide   gene model=Glyma08g34360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLGVVGLEGVVGSESGCVFGSSLASDPETKHKWYGSGLLKQERSAIASEDDEWRISKVAKTDHDMPSASKAMLFQQRNNSLLRSNNATLFSDGHHQSQMLNFSSPKSETLLVDKAFSNATLPFSYHQLSSYSKNTGYNSGSISMHGALASVRGPFTPSQWMELEHQALIYKYITANVLDKE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo