Glyma08g33580 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma08g33580

Feature Type:	gene_model
Chromosome:	Gm08
Start:	30225253
stop:	30226907
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g33580

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G00720	AT	Annotation by Michelle Graham. TAIR10: shaggy-like protein kinase 32 \| chr4:294116-297002 REVERSE LENGTH=472	SoyBase	E_val: 4.00E-44	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0009741	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus	SoyBase	N/A	ISS
GO:0046777	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0004713	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
PTHR24057	Panther	GLYCOGEN SYNTHASE KINASE-3 ALPHA	JGI		ISS
PF00069	PFAM	Protein kinase domain	JGI		ISS
UniRef100_I1L6R3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L6R3_SOYBN	SoyBase	E_val: 8.00E-52	ISS
UniRef100_Q9FSG4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Wound-induced GSK-3-like protein (Fragment) n=1 Tax=Medicago sativa RepID=Q9FSG4_MEDSA	SoyBase	E_val: 1.00E-43	ISS

Expression Patterns of Glyma08g33580

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g33580 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma08g33580

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g33580

Limit To All Plant Sequences

>Glyma08g33580.1   sequence type=CDS   gene model=Glyma08g33580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCAATCCCTTTCCATCATCTCCTCGAGCTTCTTCTCGCTCCAATGCCGTTTGATGCATATGTCGAAGGTAATAGAGAGAGAGATCGCTTGGGTAGTTGCAGGAGGGGAGGGGAGAGAAGTGAGCGCGCAAACACCAAACCACTTCCAGACACTTCTATTGAACCTCCACTGCCTTCTCTGCAATCAAAGACTTGTCTTCTGCGAATGCTTGACCATACTAATTTTCTCAGACTAAAACATTGTTTCTATTCAACGGTTGAGAAAGATGATTTGTACCTTAACCTAGTTTTGGAGTATGTACCTGAAACTGTCTACAAAGTTTCAAAGCACTATGCCAGAATGCACCAACATATGCCTATCATTAATATATGTCGGGGTTTAAATTATTTGCATCATGTGATTGGAGTCTGTCATCGGGACATCAAACCCCAGAATCTATTGACTCATCAATTAAAAGTATGTGATTTTGGGAGTGCAAAA

Predicted protein sequences of Glyma08g33580

Limit To All Plant Sequences

>Glyma08g33580.1   sequence type=predicted peptide   gene model=Glyma08g33580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AIPFHHLLELLLAPMPFDAYVEGNRERDRLGSCRRGGERSERANTKPLPDTSIEPPLPSLQSKTCLLRMLDHTNFLRLKHCFYSTVEKDDLYLNLVLEYVPETVYKVSKHYARMHQHMPIINICRGLNYLHHVIGVCHRDIKPQNLLTHQLKVCDFGSAK

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain