Glyma08g31706 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma08g31706): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma08g31706): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma08g31706

Feature Type:	gene_model
Chromosome:	Gm08
Start:	27928331
stop:	27931353
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma08g31706

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G02600	AT	Annotation by Michelle Graham. TAIR10: lipid phosphate phosphatase 3 \| chr3:552937-554411 FORWARD LENGTH=314	SoyBase	E_val: 2.00E-15	ISS
GO:0006644	GO-bp	Annotation by Michelle Graham. GO Biological Process: phospholipid metabolic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0005887	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0008195	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphatidate phosphatase activity	SoyBase	N/A	ISS
PTHR10165	Panther	LIPID PHOSPHATE PHOSPHATASE-RELATED	JGI		ISS
PTHR10165:SF45	Panther	PHOSPHATIDATE PHOSPHATASE	JGI		ISS
UniRef100_D7LR06	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATPAP1 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LR06_ARALL	SoyBase	E_val: 9.00E-13	ISS
UniRef100_I1LES4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LES4_SOYBN	SoyBase	E_val: 2.00E-16	ISS

Expression Patterns of Glyma08g31706

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma08g31706 not represented in the dataset	Glyma08g31706 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma08g31706 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.08g262600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma08g31706

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma08g31706

Limit To All Plant Sequences

>Glyma08g31706.1   sequence type=CDS   gene model=Glyma08g31706   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTCTGTTTGTGATAAGACTTCTCACTTTCTCCATCTCTCACTACTATTGCCTTAATTTCATACTTTCTTTCATTTCTGTGGATAATGATCATCACAGTTTAGCGACCGCAAATTATCTGCTTCTCTACACATGGCGTCGCGGGGTTTCTTTTCGTTCGGAAGATTTTGGCAACCGTTTCAGGAGATGTGTTTATGATTTGCACCACAGTATTCTAGGTTTGCTATTTGTTGTTCTGATAACTAGGGCCTTCACCGATGCAATAAGAAATGCAGTTGGCTGGCCTCGACCAGACTTCTTTTGGCATTGCATGAGGATACTGCCTCATGATCAAAACACTGGAGCCTTCTTCATTGTTGTAGTACAAAAAGTTTCTCCTCTGTCAGATAGTTTTTCTTATGACTAA

Predicted protein sequences of Glyma08g31706

Limit To All Plant Sequences

>Glyma08g31706.1   sequence type=predicted peptide   gene model=Glyma08g31706   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFLFVIRLLTFSISHYYCLNFILSFISVDNDHHSLATANYLLLYTWRRGVSFRSEDFGNRFRRCVYDLHHSILGLLFVVLITRAFTDAIRNAVGWPRPDFFWHCMRILPHDQNTGAFFIVVVQKVSPLSDSFSYD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain